PDB entry 5l8u

View 5l8u on RCSB PDB site
Description: Crystal Structure of BAZ2B bromodomain in complex with 3-amino-2-methylpyridine derivative 5
Class: transcription
Keywords: four helical bundle, transcription
Deposited on 2016-06-08, released 2016-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2B, KIAA1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF8 (2-115)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d5l8ua1, d5l8ua2
  • Heterogens: 6RS, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l8uA (A:)
    smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
    eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkv