PDB entry 5l8n

View 5l8n on RCSB PDB site
Description: crystal structure of human FABP6 protein with fragment 1
Class: lipid binding protein
Keywords: FABP6, Fatty acid binding protein 6, Ileal bile acid binding protein, I-BABP, Ileal, Gastrotropin, Fragments, Lipid binding protein
Deposited on 2016-06-08, released 2016-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gastrotropin
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP6, ILBP, ILLBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5l8na_
  • Chain 'B':
    Compound: Gastrotropin
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP6, ILBP, ILLBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5l8nb_
  • Chain 'C':
    Compound: Gastrotropin
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP6, ILBP, ILLBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5l8nc_
  • Heterogens: 6RQ, PEG, P33, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l8nA (A:)
    maftgkfemeseknydefmkllgissdviekarnfkivtevqqdgqdftwsqhysgghtm
    tnkftvgkesniqtmggktfkatvqmeggklvvnfpnyhqtseivgdklvevstiggvty
    ervskrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8nA (A:)
    ftgkfemeseknydefmkllgissdviekarnfkivtevqqdgqdftwsqhysgghtmtn
    kftvgkesniqtmggktfkatvqmeggklvvnfpnyhqtseivgdklvevstiggvtyer
    vskrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5l8nB (B:)
    maftgkfemeseknydefmkllgissdviekarnfkivtevqqdgqdftwsqhysgghtm
    tnkftvgkesniqtmggktfkatvqmeggklvvnfpnyhqtseivgdklvevstiggvty
    ervskrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8nB (B:)
    aftgkfemeseknydefmkllgissdviekarnfkivtevqqdgqdftwsqhysgghtmt
    nkftvgkesniqtmggktfkatvqmeggklvvnfpnyhqtseivgdklvevstiggvtye
    rvskrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5l8nC (C:)
    maftgkfemeseknydefmkllgissdviekarnfkivtevqqdgqdftwsqhysgghtm
    tnkftvgkesniqtmggktfkatvqmeggklvvnfpnyhqtseivgdklvevstiggvty
    ervskrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8nC (C:)
    ftgkfemeseknydefmkllgissdviekarnfkivtevqqdgqdftwsqhysgghtmtn
    kftvgkesniqtmggktfkatvqmeggklvvnfpnyhqtseivgdklvevstiggvtyer
    vskrl