PDB entry 5l8k

View 5l8k on RCSB PDB site
Description: Aurora-A kinase domain in complex with vNAR-D01 (crystal form 2)
Class: transferase
Keywords: kinase, vNAR, inhibitor, transferase
Deposited on 2016-06-08, released 2016-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965
      • engineered mutation (171)
    Domains in SCOPe 2.07: d5l8ka_
  • Chain 'B':
    Compound: new antigen receptor variable domain
    Species: Orectolobus maculatus [TaxId:168098]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8JJ25 (1-103)
      • initiating methionine (0)
      • conflict (86-87)
      • engineered mutation (88)
      • conflict (90-93)
      • expression tag (104)
    Domains in SCOPe 2.07: d5l8kb1, d5l8kb2
  • Heterogens: ADP, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l8kA (A:)
    gameskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehql
    rreveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyit
    elanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlagtldylpp
    emiegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegard
    lisrllkhnpsqrpmlrevlehpwitansskpsnaqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8kA (A:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlagtldylppemiegrm
    hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
    hnpsqrpmlrevlehpwitansskpsn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5l8kB (B:)
    marvdqtpriatketgesltincvlrdtacaldstnwyrtklgstkeqtisiggrysetv
    degsnsasltirdlrvedsgtykckaidscwlsregagtvltvkggaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8kB (B:)
    marvdqtpriatketgesltincvlrdtacaldstnwyrtklgstkeqtisiggrysetv
    degsnsasltirdlrvedsgtykckaidscwlsregagtvltvkg