PDB entry 5l8g

View 5l8g on RCSB PDB site
Description: Crystal structure of Rhodospirillum rubrum Rru_A0973 mutant H65A
Class: oxidoreductase
Keywords: ferritin, iron oxidation, ferroxidase, oxidoreductase
Deposited on 2016-06-07, released 2016-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 2.97 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8ga1, d5l8ga2
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8gb1, d5l8gb2
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8gc1, d5l8gc2
  • Chain 'D':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8gd1, d5l8gd2
  • Chain 'E':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
    Domains in SCOPe 2.07: d5l8ge_
  • Chain 'F':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8gf1, d5l8gf2
  • Chain 'G':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8gg1, d5l8gg2
  • Chain 'H':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8gh1, d5l8gh2
  • Chain 'I':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8gi1, d5l8gi2
  • Chain 'J':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8gj1, d5l8gj2
  • Chain 'K':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8gk1, d5l8gk2
  • Chain 'L':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8gl1, d5l8gl2
  • Chain 'M':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (64)
    Domains in SCOPe 2.07: d5l8gm_
  • Chain 'N':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8gn1, d5l8gn2
  • Chain 'O':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
    Domains in SCOPe 2.07: d5l8go_
  • Chain 'P':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8gp1, d5l8gp2
  • Chain 'Q':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
    Domains in SCOPe 2.07: d5l8gq_
  • Chain 'R':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
    Domains in SCOPe 2.07: d5l8gr_
  • Chain 'S':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (64)
    Domains in SCOPe 2.07: d5l8gs_
  • Chain 'T':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8gt1, d5l8gt2
  • Chain 'U':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8gu1, d5l8gu2
  • Chain 'V':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (64)
    Domains in SCOPe 2.07: d5l8gv_
  • Chain 'W':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
    Domains in SCOPe 2.07: d5l8gw_
  • Chain 'X':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (64)
    Domains in SCOPe 2.07: d5l8gx_
  • Chain 'Y':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (64)
    Domains in SCOPe 2.07: d5l8gy_
  • Chain 'Z':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (64)
    Domains in SCOPe 2.07: d5l8gz_
  • Chain 'a':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
      • expression tag (96)
  • Chain 'b':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (64)
  • Chain 'c':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (64)
  • Chain 'd':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (64)
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l8gA (A:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gA (A:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5l8gB (B:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gB (B:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5l8gC (C:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gC (C:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5l8gD (D:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gD (D:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5l8gE (E:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gE (E:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5l8gF (F:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gF (F:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5l8gG (G:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gG (G:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5l8gH (H:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gH (H:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5l8gI (I:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gI (I:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5l8gJ (J:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gJ (J:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5l8gK (K:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gK (K:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5l8gL (L:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gL (L:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5l8gM (M:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gM (M:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5l8gN (N:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gN (N:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5l8gO (O:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gO (O:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5l8gP (P:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gP (P:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5l8gQ (Q:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gQ (Q:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5l8gR (R:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gR (R:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5l8gS (S:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gS (S:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5l8gT (T:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gT (T:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >5l8gU (U:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gU (U:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >5l8gV (V:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gV (V:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5l8gW (W:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gW (W:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5l8gX (X:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gX (X:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >5l8gY (Y:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gY (Y:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >5l8gZ (Z:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8gZ (Z:)
    theplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaaa
    mtlewlrrndakwaehlrtylftegpi
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.