PDB entry 5l8e

View 5l8e on RCSB PDB site
Description: structure of uaf1
Deposited on 2016-06-07, released 2016-09-28
The last revision was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WD repeat-containing protein 48
    Species: Homo sapiens [TaxId:9606]
    Gene: WDR48, KIAA1449, UAF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TAF3
      • conflict (368)
  • Chain 'B':
    Compound: WD repeat-containing protein 48
    Species: Homo sapiens [TaxId:9606]
    Gene: WDR48, KIAA1449, UAF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TAF3
      • conflict (368)
  • Chain 'C':
    Compound: unknown
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5L8E (0-4)
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l8eA (A:)
    wshpqfektagrrkvqvsyvirdevekynrngvnalqldpalnrlftagrdsiiriwsvn
    qhkqdpyiasmehhtdwvndivlccngktlisassdttvkvwnahkgfcmstlrthkdyv
    kalayakdkelvasagldrqiflwdvntltaltasnntvttsslsgnkdsiyslamnqlg
    tiivsgstekvlrvwdprtcaklmklkghtdnvkalllnrdgtqclsgssdgtirlwslg
    qqrciatyrvhdegvwalqvndafthvysggrdrkiyctdlrnpdirvliceekapvlkm
    eldrsadpppaiwvattkstvnkwtlkgihnfrasgdydndctnpitplctqpdqvikgg
    asiiqchifndkrhiltkdtnnnvaywdvlkackvedlgkvdfedeikkrfkmvyvpnwf
    svdlktgmltitldesdcfaawvsakdagfsspdgsdpklnlgglllqalleywprthvn
    pmdeeenevnhvngeqenrvqkgngyfqvpphtpvifgeaggrtlfrllcrdsggetesm
    llnetvpqwviditvdknmpkfnkipfylqphassgaktl
    

    Sequence, based on observed residues (ATOM records):
    >5l8eA (A:)
    rrkvqvsyvirdevekynrngvnalqldpalnrlftagrdsiiriwsvnqhkqdpyiasm
    ehhtdwvndivlccngktlisassdttvkvwnahkgfcmstlrthkdyvkalayakdkel
    vasagldrqiflwdvntltaltasnntvttsslsgnkdsiyslamnqlgtiivsgstekv
    lrvwdprtcaklmklkghtdnvkalllnrdgtqclsgssdgtirlwslgqqrciatyrvh
    degvwalqvndafthvysggrdrkiyctdlrnpdirvliceekapvlkmeldrsadpppa
    iwvattkstvnkwtlkgihplctqpdqvikggasiiqchifndkrhiltkdtnnnvaywd
    vlkackvedlgkvdfedeikkrfkmvyvpnwfsvdlktgmltitldesdcfaawvsakda
    gfsspdgsdpklnlgglllqalleywprthvnpmnrvqkgngyfqvpphtpvifgeaggr
    tlfrllcrdsggetesmllnetvpqwviditvdknmp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5l8eB (B:)
    wshpqfektagrrkvqvsyvirdevekynrngvnalqldpalnrlftagrdsiiriwsvn
    qhkqdpyiasmehhtdwvndivlccngktlisassdttvkvwnahkgfcmstlrthkdyv
    kalayakdkelvasagldrqiflwdvntltaltasnntvttsslsgnkdsiyslamnqlg
    tiivsgstekvlrvwdprtcaklmklkghtdnvkalllnrdgtqclsgssdgtirlwslg
    qqrciatyrvhdegvwalqvndafthvysggrdrkiyctdlrnpdirvliceekapvlkm
    eldrsadpppaiwvattkstvnkwtlkgihnfrasgdydndctnpitplctqpdqvikgg
    asiiqchifndkrhiltkdtnnnvaywdvlkackvedlgkvdfedeikkrfkmvyvpnwf
    svdlktgmltitldesdcfaawvsakdagfsspdgsdpklnlgglllqalleywprthvn
    pmdeeenevnhvngeqenrvqkgngyfqvpphtpvifgeaggrtlfrllcrdsggetesm
    llnetvpqwviditvdknmpkfnkipfylqphassgaktl
    

    Sequence, based on observed residues (ATOM records):
    >5l8eB (B:)
    rrkvqvsyvirdevekynrngvnalqldpalnrlftagrdsiiriwsvnqhkqdpyiasm
    ehhtdwvndivlccngktlisassdttvkvwnahkgfcmstlrthkdyvkalayakdkel
    vasagldrqiflwdvntltaltasnntvttsslsgnkdsiyslamnqlgtiivsgstekv
    lrvwdprtcaklmklkghtdnvkalllnrdgtqclsgssdgtirlwslgqqrciatyrvh
    degvwalqvndafthvysggrdrkiyctdlrnpdirvliceekapvlkmeldrsadpppa
    iwvattkstvnkwtlkgihplctqpdqvikggasiiqchifndkrhiltkdtnnnvaywd
    vlkackvedlgkvdfedeikkrfkmvyvpnwfsvdlktgmltitldesdcfaawvsakda
    gfsspdgsdpklnlgglllqalleywprthvnpmnrvqkgngyfqvpphtpvifgeaggr
    tlfrllcrdsggetesmllnetvpqwviditvdknmp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5l8eC (C:)
    xxxxx