PDB entry 5l8b

View 5l8b on RCSB PDB site
Description: Crystal structure of Rhodospirillum rubrum Rru_A0973 mutant E62A
Class: oxidoreductase
Keywords: ferritin, iron oxidation, ferroxidase, oxidoreductase
Deposited on 2016-06-07, released 2016-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8ba_
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8bb_
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8bc_
  • Chain 'D':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8bd_
  • Chain 'E':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (61)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8be1, d5l8be2
  • Chain 'F':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8bf_
  • Chain 'G':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8bg_
  • Chain 'H':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8bh_
  • Chain 'I':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (61)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8bi1, d5l8bi2
  • Chain 'J':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (61)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8bj1, d5l8bj2
  • Chain 'K':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8bk_
  • Chain 'L':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8bl_
  • Chain 'M':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8bm_
  • Chain 'N':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8bn_
  • Chain 'O':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (61)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8bo1, d5l8bo2
  • Chain 'P':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8bp_
  • Chain 'Q':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (61)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8bq1, d5l8bq2
  • Chain 'R':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (61)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8br1, d5l8br2
  • Chain 'S':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (61)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8bs1, d5l8bs2
  • Chain 'T':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8bt_
  • Chain 'U':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (61)
      • expression tag (96)
    Domains in SCOPe 2.07: d5l8bu1, d5l8bu2
  • Chain 'V':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8bv_
  • Chain 'W':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8bw_
  • Chain 'X':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8bx_
  • Chain 'Y':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8by_
  • Chain 'Z':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5l8bz_
  • Chain 'a':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
  • Chain 'b':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
  • Chain 'c':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (61)
  • Chain 'd':
    Compound: Uncharacterized protein
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (61)
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l8bA (A:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bA (A:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5l8bB (B:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bB (B:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5l8bC (C:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bC (C:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5l8bD (D:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bD (D:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5l8bE (E:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bE (E:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5l8bF (F:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bF (F:)
    theplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakehaa
    mtlewlrrndakwaehlrtylftegpit
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5l8bG (G:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bG (G:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5l8bH (H:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bH (H:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5l8bI (I:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bI (I:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5l8bJ (J:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bJ (J:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5l8bK (K:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bK (K:)
    theplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakehaa
    mtlewlrrndakwaehlrtylftegpit
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5l8bL (L:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bL (L:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5l8bM (M:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bM (M:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5l8bN (N:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bN (N:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5l8bO (O:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bO (O:)
    theplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakehaa
    mtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5l8bP (P:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bP (P:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5l8bQ (Q:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bQ (Q:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5l8bR (R:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bR (R:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5l8bS (S:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bS (S:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5l8bT (T:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bT (T:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >5l8bU (U:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bU (U:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >5l8bV (V:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bV (V:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakeha
    amtlewlrrndakwaehlrtylft
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5l8bW (W:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bW (W:)
    theplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakehaa
    mtlewlrrndakwaehlrtylftegpit
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5l8bX (X:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bX (X:)
    theplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakehaa
    mtlewlrrndakwaehlrtylftegpit
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >5l8bY (Y:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bY (Y:)
    theplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakehaa
    mtlewlrrndakwaehlrtylftegpit
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >5l8bZ (Z:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eakehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8bZ (Z:)
    theplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakehaa
    mtlewlrrndakwaehlrtylftegpit
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.