PDB entry 5l88

View 5l88 on RCSB PDB site
Description: AFAMIN ANTIBODY FRAGMENT, N14 FAB, L1- GLYCOSILATED, CRYSTAL FORM I, non-parsimonious model
Class: immune system
Keywords: Afamin antibody, Fab Fragment, IgG1-kappa, light chain glycosilation, immune system
Deposited on 2016-06-07, released 2016-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Anti-afamin antibody N14, Fab fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5L88 (0-End)
  • Chain 'L':
    Compound: Anti-afamin antibody N14, Fab fragment, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5L88 (0-214)
    Domains in SCOPe 2.07: d5l88l1, d5l88l2
  • Heterogens: PG4, PE8, PGE, PEG, K, 1PE, NAG, FUC, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l88L (L:)
    divltqtpaimsaslgervtmtctanssvssnyfhwyqqkpgsspklwiystsnlasgvp
    trfsgsgsgtsysltlssmeaedaatyychqyhrspptfgsgtklkmkradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec