PDB entry 5l7x

View 5l7x on RCSB PDB site
Description: Afamin antibody fragment, N14 Fab, L1- glycosylated, crystal form II
Class: immune system
Keywords: Fab, Antibody Fragment, glycosilated, Afamin, immune system
Deposited on 2016-06-04, released 2016-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Mouse Antibody Fab Fragment, IgG1-kappa Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5L7X (0-End)
  • Chain 'L':
    Compound: Mouse Antibody Fab Fragment, IgG1-kappa Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5L7X (0-End)
    Domains in SCOPe 2.07: d5l7xl1, d5l7xl2
  • Heterogens: PG4, PEG, 1PE, NAG, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5l7xL (L:)
    divltqtpaimsaslgervtmtctanssvssnyfhwyqqkpgsspklwiystsnlasgvp
    trfsgsgsgtsysltlssmeaedaatyychqyhrspptfgsgtklkmkradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l7xL (L:)
    divltqtpaimsaslgervtmtctanssvssnyfhwyqqkpgsspklwiystsnlasgvp
    trfsgsgsgtsysltlssmeaedaatyychqyhrspptfgsgtklkmkradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrne