PDB entry 5l7v

View 5l7v on RCSB PDB site
Description: crystal structure of bvgh123 with bond transition state analog galthiazoline.
Deposited on 2016-06-03, released 2017-03-22
The last revision was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycoside hydrolase
    Species: Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154) [TaxId:435590]
    Gene: BVU_2198
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: glycoside hydrolase
    Species: Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154) [TaxId:435590]
    Gene: BVU_2198
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GNL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5l7vA (A:)
    qtseyyqeaanpiatnpalwakvtapqiswgstdirykkeepapihsaqksmnltawkge
    kisaqlvvwtpkvlndltfmvsdltsgsatiskenirtgfvryvitdelnkdglgacgyr
    nsadfdstlvadvidhitptltlpanstqggwisvnipqgtkagkytgtvtvkadgitls
    elklnlqvknrtlpppsewafhldlwqnpyavsryynvepfskkhfdlmrplmklyadag
    gkvitasimhkpwngqtydafesmvtwlkkadgtwyfdytvfdkwvefmmdlgvkkqisc
    ysmvpwrlsfqyfdqasnsfkfldakpgevayeefwmnmlqdfskhlkakgwfdithiam
    derpmkdmqetlkvirkadkdfkvslagtyhkellddlndycitiaekftpeeiearrka
    gkvttyytccteprpntftfsepaeaewlawhsakenldgylrwalnswvknplqdsrft
    awaagdtymiypgarssirlerltegiqffekvrilkeefeekgnkgaiknidktlkmfd
    essmdkispttavnkakkvinry
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5l7vB (B:)
    qtseyyqeaanpiatnpalwakvtapqiswgstdirykkeepapihsaqksmnltawkge
    kisaqlvvwtpkvlndltfmvsdltsgsatiskenirtgfvryvitdelnkdglgacgyr
    nsadfdstlvadvidhitptltlpanstqggwisvnipqgtkagkytgtvtvkadgitls
    elklnlqvknrtlpppsewafhldlwqnpyavsryynvepfskkhfdlmrplmklyadag
    gkvitasimhkpwngqtydafesmvtwlkkadgtwyfdytvfdkwvefmmdlgvkkqisc
    ysmvpwrlsfqyfdqasnsfkfldakpgevayeefwmnmlqdfskhlkakgwfdithiam
    derpmkdmqetlkvirkadkdfkvslagtyhkellddlndycitiaekftpeeiearrka
    gkvttyytccteprpntftfsepaeaewlawhsakenldgylrwalnswvknplqdsrft
    awaagdtymiypgarssirlerltegiqffekvrilkeefeekgnkgaiknidktlkmfd
    essmdkispttavnkakkvinry
    

    Sequence, based on observed residues (ATOM records):
    >5l7vB (B:)
    tseyyqeaanpiatnpalwakvtapqiswgstdirykkeepapihsaqksmnltawkgek
    isaqlvvwtpkvlndltfmvsdltsgsatiskenirtgfvryvitdelnkdglgacgyrn
    sadfdstlvadvidhitptltlpanstqggwisvnipqgtkagkytgtvtvkadgitlse
    lklnlqvknrtlpppsewafhldlwqnpyavsryynvepfskkhfdlmrplmklyadagg
    kvitasimhkpwngqtydafesmvtwlkkadgtwyfdytvfdkwvefmmdlgvkkqiscy
    smvpwrlsfqyfdqasnsfkfldakpgevayeefwmnmlqdfskhlkakgwfdithiamd
    erpmkdmqetlkvirkadkdfkvslagtyhkellddlndycitiaekftpeeiearrkag
    kvttyytccteprpntftfsepaeaewlawhsakenldgylrwalnswvknplqdsrfta
    waagdtymiypgarssirlerltegiqffekvrilkeefeekgnkgaiknidktlkmfde
    ssmdkispttavnkakkvinry