PDB entry 5l7t

View 5l7t on RCSB PDB site
Description: 17beta-hydroxysteroid dehydrogenase 14 variant T205 in complex with a non-steroidal inhibitor.
Class: oxidoreductase
Keywords: hydroxysteroid dehydrogenase, inhibitor complex, oxidoreductase
Deposited on 2016-06-03, released 2016-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 17-beta-hydroxysteroid dehydrogenase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B14, DHRS10, SDR3, SDR47C1, UNQ502/PRO474
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BPX1 (Start-271)
      • expression tag (272)
    Domains in SCOPe 2.06: d5l7ta1, d5l7ta2
  • Heterogens: NAD, NA, 6QJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l7tA (A:)
    ghmatgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavf
    ilcdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgt
    ytltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvr
    vncispgniwtplweelaalmpdpratiregmlaqplgrmgqpaevgaaavflaseanfc
    tgiellvtggaelgygckasrstpvdapdipsgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l7tA (A:)
    gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
    tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
    lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
    pgniwtplweelaalmpdpratiregmlaqplgrmgqpaevgaaavflaseanfctgiel
    lvtggaelgygckpsg