PDB entry 5l7s

View 5l7s on RCSB PDB site
Description: crystal structure of rxlr effector pexrd54 from phytophthora infestans
Deposited on 2016-06-03, released 2016-08-03
The last revision was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Secreted RxLR effector peptide protein
    Species: Phytophthora infestans [TaxId:4787]
    Gene: PITG_09316
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l7sA (A:)
    gpvtsslsaeeaqlkvwiqsqihprelfgvlslgkraaklddnpdfvqwlrlvkdfrann
    gnqafsdldiyylllktnspeqlkllfetlrhtpgmtkigasmekslsgnwirkaleqdt
    yptivyntlrlkdagtklddtpmfrqwleyvekywnknagaffgdtqmltlfqktmteee
    diiklvhmlrnnpgmkshadkleryllltsesshktmadvwlkaretpeevfrilrlaek
    qtaaaddnrmlnlwlrytqtyrdkidknafsdaealqffrkakpldfdweiv
    

    Sequence, based on observed residues (ATOM records):
    >5l7sA (A:)
    saeeaqlkvwiqsqihprelfgvlslgkraaklddnpdfvqwlrlvkdfranngnqafsd
    ldiyylllktnspeqlkllfetlrhtpgmtkigasmekslsgnwirkaleqdtyptivyn
    tlrlkdagtklddtpmfrqwleyvekywnknffgdtqmltlfqktmteeediiklvhmlr
    nnpgmkshadkleryllltsesshktmadvwlkaretpeevfrilrlaekqddnrmlnlw
    lrytqtyrdkidknafsdaealqffrk