PDB entry 5l76

View 5l76 on RCSB PDB site
Description: crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase domain (in apo form)
Deposited on 2016-06-02, released 2017-05-10
The last revision was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-aminoadipic semialdehyde synthase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: AASS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UDR5
      • conflict (185)
  • Heterogens: EDO, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l76A (A:)
    mghhhhhhssgvdlgtenlyfqsmalpdkykyiqtlresreraqslsmgtrrkvlvlgsg
    yisepvleylsrdgnieitvgsdmknqieqlgkkyninpvsmdickqeeklgflvakqdl
    visllpyvlhplvakacitnkvnmvtasyitpalkeleksvedagitiigelgldpgldh
    mlamesidkakevgatiesyisycgglpapehsnnplrykfswspvgvlmnvmqsatyll
    dgkvvnvaggisfldavtsmdffpglnlegypnrdstkyaeiygissahtllrgtlrykg
    ymkalngfvklglinrealpafrpeanpltwkqllcdlvgispssehdvlkeavlkklgg
    dntqleaaewlgllgdeqvpqaesildalskhlvmklsygpeekdmivmrdsfgirhpsg
    hlehktidlvaygdingfsamaktvglptamaakmlldgeigakglmgpfskeiygpile
    rikaegiiyttqstikp
    

    Sequence, based on observed residues (ATOM records):
    >5l76A (A:)
    rkvlvlgsgyisepvleylsrdgnieitvgsdmknqieqlgkkyninpvsmdickqeekl
    gflvakqdlvisllpyvlhplvakacitnkvnmvtasyitpalkeleksvedagitiige
    lgldpgldhmlamesidkakevgatiesyisycgglpapehsnnplrykfswspvgvlmn
    vmqsatylldgkvvnvaggisfldavtsmdffpglnlegypnrdstkyaeiygissahtl
    lrgtlrykgymkalngfvklglinrealpnpltwkqllcdlvgispssehdvlkeavlkk
    lggdntqleaaewlgllgdeqvpqaesildalskhlvmklsygpeekdmivmrdsfgirh
    psghlehktidlvaygdingfsamaktvglptamaakmlldgeigakglmgpfskeiygp
    ilerikaegiiyttqstik