PDB entry 5l75

View 5l75 on RCSB PDB site
Description: a protein structure
Deposited on 2016-06-01, released 2017-08-16
The last revision was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 3.7 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipopolysaccharide ABC transporter, ATP-binding protein LptB
    Species: Klebsiella pneumoniae IS22 [TaxId:1432547]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Lipopolysaccharide ABC transporter, ATP-binding protein LptB
    Species: Klebsiella pneumoniae IS22 [TaxId:1432547]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: FIG000988: Predicted permease
    Species: Klebsiella pneumoniae IS22 [TaxId:1432547]
    Database cross-references and differences (RAF-indexed):
    • Uniprot W1B830
      • conflict (106)
      • conflict (203)
  • Chain 'G':
    Compound: FIG000906: Predicted Permease
    Species: Klebsiella pneumoniae IS22 [TaxId:1432547]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PT

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l75A (A:)
    matltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagni
    iiddedisllplhararrgigylpqeasifrrlsvydnlmavlqirddltseqredrake
    lmeefhiehlrdslgqalsggerrrveiaralaanpkfilldepfagvdpisvidikrii
    ehlrdsglgvlitdhnvretlavcerayivsqghliahgtpqqiledeqvkrvylgedfr
    l
    

    Sequence, based on observed residues (ATOM records):
    >5l75A (A:)
    atltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagnii
    iddedisllplhararrgigylpqeasifrrlsvydnlmavlqirddltseqredrakel
    meefhiehlrdslgqalsggerrrveiaralaanpkfilldepfagvdpisvidikriie
    hlrdsglgvlitdhnvretlavcerayivsqghliahgtpqqiledeqvkrvylg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5l75B (B:)
    matltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagni
    iiddedisllplhararrgigylpqeasifrrlsvydnlmavlqirddltseqredrake
    lmeefhiehlrdslgqalsggerrrveiaralaanpkfilldepfagvdpisvidikrii
    ehlrdsglgvlitdhnvretlavcerayivsqghliahgtpqqiledeqvkrvylgedfr
    l
    

    Sequence, based on observed residues (ATOM records):
    >5l75B (B:)
    matltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagni
    iiddedisllplhararrgigylpqeasifrrlsvydnlmavlqirddltseqredrake
    lmeefhiehlrdslgqalsggerrrveiaralaanpkfilldepfagvdpisvidikrii
    ehlrdsglgvlitdhnvretlavcerayivsqghliahgtpqqiledeqvkrvylge
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5l75F (F:)
    miiirylvretlksqlailfillliffcqklvrilgaavdgdiptnlvlsllglgipema
    qlilplslflgllmtlgklyteseitvmhacglskavlikaamilavftgavaavnvmwa
    gpwssrhqdevlaeakanpgmaalaqgqfqqasdgnavmfiesvngnrfhdvflaqlrpk
    gnarpsvvvadsgelsqqkdgsqyvtlnkgtrfegtamlrdfritdfnnyqaiighqavs
    adpddteqmdmrtlwkthtdraraelhwrftlvatvfimalmvvplsvvnprqgrvlsml
    pamllylvffllqtsiksnggkgkmdpaiwmwainllyfalavllnlwdtvpmrrfrarf
    nkgaa
    

    Sequence, based on observed residues (ATOM records):
    >5l75F (F:)
    iiirylvretlksqlailfillliffcqklvrilgaavdgdiptnlvlsllglgipemaq
    lilplslflgllmtlgklyteseitvmhacglskavlikaamilavftgavaavnvmwag
    pwssrhqdevlaeakanpgmaalaqgqfqqasdgnavmfiesvngnrfhdvflaqsvvva
    dsgelsqqqyvtlnkgtrfegtamlrdfritdfnnyqaiighqavsadtlwkthtdraae
    lhwrftlvatvfimalmvvplsvvnprqgrvlsmlpamllylvffllqtsiksnggkgkm
    dpaiwmwainllyfalavllnlw
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5l75G (G:)
    mqafgvldryigktifntimmtlfmlvslsgiikfvdqlkksgqgsydalgaglytilsv
    pkdiqiffpmaallgallglgmlaqrselvvmqasgftrlqvalavmktaiplvlltmai
    gewvapqgeqmarnyraqqmyggsllstqqglwakdghnfvyiervkgndelggvsiyaf
    nperrlqsvryaasakfdsenkvwrlsqvdesdltdpkqvtgsqmvsgtwktnltpdklg
    vvaldpdalsisglhnyvkylkssgqdpgryqlnmwskifqplsvavmmlmalsfifgpl
    rsvpmgvrvvtgisfgfifyvldqifgpltlvygippiigallpsasfflislwlmmrka
    

    Sequence, based on observed residues (ATOM records):
    >5l75G (G:)
    vldryigktifntimmtlfmlvslsgiikfvdqlkksgqgsydalgaglytilsvpkdiq
    iffpmaallgallglgmlaqrselvvmqasgftrlqvalavmktaiplvlltmaigewva
    pqgeqmarnyraqqmyggsllstqqglwakdghnfvyiervkgndelggvsiyafnperr
    lqsvryaasakfdsenwrlsqvdesdltdpkqvtgsqmvnltpdklgvvaldpdalsisg
    lhnyvkypgryqlnmwskifqplsvavmmlmalsfifgplrsvpmgvrvvtgisfgfify
    vldqifgpltlvygippiigallpsasfflislwlmmrka