PDB entry 5l6z

View 5l6z on RCSB PDB site
Description: crystal structure of d62a mutant of thermotoga maritima tmpep1050 aminopeptidase
Deposited on 2016-06-01, released 2017-06-21
The last revision was dated 2021-02-24, with a file datestamp of 2021-02-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucylaminopeptidase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: TM_1050, Tmari_1054
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0E0 (0-330)
      • engineered mutation (61)
  • Chain 'B':
    Compound: leucylaminopeptidase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: TM_1050, Tmari_1054
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0E0 (0-330)
      • engineered mutation (61)
  • Heterogens: CIT, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l6zA (A:)
    mkelirklteafgpsgreeevrsiileeleghidghridglgnlivwkgsgekkvildah
    iaeigvvvtnvddkgfltiepvggvspymllgkrirfengtigvvgmegetteerqenvr
    klsfdklfidigansreeaqkmcpigsfgvydsgfvevsgkyvskamddrigcavivevf
    krikpavtlygvfsvqeevglvgasvagygvpadeaiaidvtdsadtpkaikrhamrlsg
    gpalkvkdrasisskrilenlieiaekfdikyqmevltfggtnamgyqrtregipsatvs
    iptryvhspsemiapddveatvdllirylga
    

    Sequence, based on observed residues (ATOM records):
    >5l6zA (A:)
    mkelirklteafgpsgreeevrsiileeleghidghridglgnlivwkgsgekkvildah
    iaeigvvvtnvddkgfltiepvggvspymllgkrirfengtigvvgmegetteerqenvr
    klsfdklfidigansreeaqkmcpigsfgvydsgfvevsgkyvskamddrigcavivevf
    krikpavtlygvfsvqeevgygvpadeaiaidvtdsadtpkaikrhamrlsggpalkvkd
    rasisskrilenlieiaekfdikyqmevltfgipsatvsiptryvhspsemiapddveat
    vdllirylga
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5l6zB (B:)
    mkelirklteafgpsgreeevrsiileeleghidghridglgnlivwkgsgekkvildah
    iaeigvvvtnvddkgfltiepvggvspymllgkrirfengtigvvgmegetteerqenvr
    klsfdklfidigansreeaqkmcpigsfgvydsgfvevsgkyvskamddrigcavivevf
    krikpavtlygvfsvqeevglvgasvagygvpadeaiaidvtdsadtpkaikrhamrlsg
    gpalkvkdrasisskrilenlieiaekfdikyqmevltfggtnamgyqrtregipsatvs
    iptryvhspsemiapddveatvdllirylga
    

    Sequence, based on observed residues (ATOM records):
    >5l6zB (B:)
    mkelirklteafgpsgreeevrsiileeleghidghridglgnlivwkgsgekkvildah
    iaeigvvvtnvddkgfltiepvggvspymllgkrirfengtigvvgmegetteerqenvr
    klsfdklfidigansreeaqkmcpigsfgvydsgfvevsgkyvskamddrigcavivevf
    krikpavtlygvfsvqeevglvgagygvpadeaiaidvtdsadtpkaikrhamrlsggpa
    lkvkdrasisskrilenlieiaekfdikyqmevlgipsatvsiptryvhspsemiapddv
    eatvdllirylga