PDB entry 5l6s

View 5l6s on RCSB PDB site
Description: crystal structure of e. coli adp-glucose pyrophosphorylase (agpase) in complex with a positive allosteric regulator beta-fructose-1,6- diphosphate (fbp) - agpase*fbp
Deposited on 2016-05-31, released 2016-09-07
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 3.04 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-1-phosphate adenylyltransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: glgC, b3430, JW3393
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Glucose-1-phosphate adenylyltransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: glgC, b3430, JW3393
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Glucose-1-phosphate adenylyltransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: glgC, b3430, JW3393
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Glucose-1-phosphate adenylyltransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: glgC, b3430, JW3393
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Glucose-1-phosphate adenylyltransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: glgC, b3430, JW3393
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Glucose-1-phosphate adenylyltransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: glgC, b3430, JW3393
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Glucose-1-phosphate adenylyltransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: glgC, b3430, JW3393
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Glucose-1-phosphate adenylyltransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: glgC, b3430, JW3393
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Glucose-1-phosphate adenylyltransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: glgC, b3430, JW3393
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Glucose-1-phosphate adenylyltransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: glgC, b3430, JW3393
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Glucose-1-phosphate adenylyltransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: glgC, b3430, JW3393
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Glucose-1-phosphate adenylyltransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: glgC, b3430, JW3393
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Glucose-1-phosphate adenylyltransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: glgC, b3430, JW3393
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Glucose-1-phosphate adenylyltransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: glgC, b3430, JW3393
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Glucose-1-phosphate adenylyltransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: glgC, b3430, JW3393
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Glucose-1-phosphate adenylyltransferase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: glgC, b3430, JW3393
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, FBP

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l6sA (A:)
    mvslekndhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsn
    cinsgirrmgvitqyqshtlvqhiqrgwsffneemnefvdllpaqqrmkgenwyrgtada
    vtqnldiirrykaeyvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgv
    mavdendkiiefvekpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdf
    gkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmy
    drnwpirtyneslppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfc
    nidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtre
    mlrklghkqer
    

    Sequence, based on observed residues (ATOM records):
    >5l6sA (A:)
    lmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsncinsgirrm
    gvitqyqshtlvqhiqrgwsffneemnefvdllpatadavtqnldiirrykaeyvvilag
    dhiykqdysrmlidhvekgarctvacmpvpieeasafgvmavdendkiiefvekpanpps
    mpndpskslasmgiyvfdadylyelleeddrdensshdfgkdlipkiteaglayahpfpl
    scvqsdpdaepywrdvgtleaywkanldlasvvpeldmydrnwpirtyneslppakfvqd
    rsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfcnidsavllpevwvgrscrlrr
    cvidracvipegmvigenaeedarrfyrseegivlvtremlrklghkqe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5l6sB (B:)
    mvslekndhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsn
    cinsgirrmgvitqyqshtlvqhiqrgwsffneemnefvdllpaqqrmkgenwyrgtada
    vtqnldiirrykaeyvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgv
    mavdendkiiefvekpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdf
    gkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmy
    drnwpirtyneslppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfc
    nidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtre
    mlrklghkqer
    

    Sequence, based on observed residues (ATOM records):
    >5l6sB (B:)
    dhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsncinsgir
    rmgvitqyqshtlvqhiqrgwsffneemnefvdllpaqqrmgtadavtqnldiirrykae
    yvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgvmavdendkiiefve
    kpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdfgkdlipkiteagla
    yahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmydrnwpirtyneslp
    pakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfcnidsavllpevwvg
    rscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtremlrklghkqer
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5l6sC (C:)
    mvslekndhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsn
    cinsgirrmgvitqyqshtlvqhiqrgwsffneemnefvdllpaqqrmkgenwyrgtada
    vtqnldiirrykaeyvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgv
    mavdendkiiefvekpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdf
    gkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmy
    drnwpirtyneslppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfc
    nidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtre
    mlrklghkqer
    

    Sequence, based on observed residues (ATOM records):
    >5l6sC (C:)
    rqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsncinsgirrmgvit
    qyqshtlvqhiqrgwsffneemnefvdllpaqqrmkgenwyrgtadavtqnldiirryka
    eyvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgvmavdendkiiefv
    ekpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdfgkdlipkiteagl
    ayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmydrnwpirtynesl
    ppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfcnidsavllpevwv
    grscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtremlrklghkqer
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5l6sD (D:)
    mvslekndhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsn
    cinsgirrmgvitqyqshtlvqhiqrgwsffneemnefvdllpaqqrmkgenwyrgtada
    vtqnldiirrykaeyvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgv
    mavdendkiiefvekpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdf
    gkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmy
    drnwpirtyneslppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfc
    nidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtre
    mlrklghkqer
    

    Sequence, based on observed residues (ATOM records):
    >5l6sD (D:)
    rqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsncinsgirrmgvit
    qyqshtlvqhiqrgwsffneemnefvdllpagtadavtqnldiirrykaeyvvilagdhi
    ykqdysrmlidhvekgarctvacmpvpieeasafgvmavddkiiefvekpanppsmpndp
    skslasmgiyvfdadylyelleeddrdehdfgkdlipkiteaglayahpfplscvqsdpd
    aepywrdvgtleaywkanldlasvvpeldmydrnwpirtyneslppakfvqdrsgshgmt
    lnslvsggcvisgsvvvqsvlfsrvrvnsfcnidsavllpevwvgrscrlrrcvidracv
    ipegmvigenaeedarrfyrseegivlvtremlrklghkqer
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5l6sE (E:)
    mvslekndhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsn
    cinsgirrmgvitqyqshtlvqhiqrgwsffneemnefvdllpaqqrmkgenwyrgtada
    vtqnldiirrykaeyvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgv
    mavdendkiiefvekpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdf
    gkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmy
    drnwpirtyneslppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfc
    nidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtre
    mlrklghkqer
    

    Sequence, based on observed residues (ATOM records):
    >5l6sE (E:)
    arqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsncinsgirrmgvi
    tqyqshtlvqhiqrgwsffneemnefvdllpaqqgtadavtqnldiirrykaeyvvilag
    dhiykqdysrmlidhvekgarctvacmpvpieeasafgvmavddkiiefvekpanppsmp
    ndpskslasmgiyvfdadylyelleeddrdensshdfgkdlipkiteaglayahpfplsc
    vqsdpdaepywrdvgtleaywkanldlasvvpeldmydrnwpirtyneslppakfvqdrs
    gshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfcnidsavllpevwvgrscrlrrcv
    idracvipegmvigenaeedarrfyrseegivlvtremlrklghkqer
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5l6sF (F:)
    mvslekndhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsn
    cinsgirrmgvitqyqshtlvqhiqrgwsffneemnefvdllpaqqrmkgenwyrgtada
    vtqnldiirrykaeyvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgv
    mavdendkiiefvekpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdf
    gkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmy
    drnwpirtyneslppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfc
    nidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtre
    mlrklghkqer
    

    Sequence, based on observed residues (ATOM records):
    >5l6sF (F:)
    rqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsncinsgirrmgvit
    qshtlvqhiqrgwsffneemnefvdllpaqgtadavtqnldiirrykaeyvvilagdhiy
    kqdysrmlidhvekgarctvacmpvpieeasafgvmavdkiiefvekpanppsmpndpsk
    slasmgiyvfdadylyelleeddrdensshdfgkdlipkiteaglayahpfplscvqsdp
    daepywrdvgtleaywkanldlasvvpeldmydrnwpirtyneslppakfvqdrsgshgm
    tlnslvsggcvisgsvvvqsvlfsrvrvnsfcnidsavllpevwvgrscrlrrcvidrac
    vipegmvigenaeedarrfyrseegivlvtremlrklghkqe
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5l6sG (G:)
    mvslekndhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsn
    cinsgirrmgvitqyqshtlvqhiqrgwsffneemnefvdllpaqqrmkgenwyrgtada
    vtqnldiirrykaeyvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgv
    mavdendkiiefvekpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdf
    gkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmy
    drnwpirtyneslppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfc
    nidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtre
    mlrklghkqer
    

    Sequence, based on observed residues (ATOM records):
    >5l6sG (G:)
    dhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsncinsgir
    rmgvitshtlvqhiqrgwsffneemnefvdllpaqgtadavtqnldiirrykaeyvvila
    gdhiykqdysrmlidhvekgarctvacmpvpieeasafgvmavddkiiefvekpanppsm
    pndpskslasmgiyvfdadylyelleeddrdensshdfgkdlipkiteaglayahpfpls
    cvqsdpdaepywrdvgtleaywkanldlasvvpeldmydrnwpirtyneslppakfvqdr
    sgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfcnidsavllpevwvgrscrlrrc
    vidracvipegmvigenaeedarrfyrseegivlvtremlrklghkqer
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5l6sH (H:)
    mvslekndhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsn
    cinsgirrmgvitqyqshtlvqhiqrgwsffneemnefvdllpaqqrmkgenwyrgtada
    vtqnldiirrykaeyvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgv
    mavdendkiiefvekpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdf
    gkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmy
    drnwpirtyneslppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfc
    nidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtre
    mlrklghkqer
    

    Sequence, based on observed residues (ATOM records):
    >5l6sH (H:)
    lmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsncinsgirrm
    gvitqyqshtlvqhiqrgwsffneemnefvdllpargtadavtqnldiirrykaeyvvil
    agdhiykqdysrmlidhvekgarctvacmpvpieeasafgvmavdkiiefvekpanppsm
    pndpskslasmgiyvfdadylyelleeddrdensshdfgkdlipkiteaglayahpfpls
    cvqsdpdaepywrdvgtleaywkanldlasvvpeldmydrnwpirtyneslppakfvqdr
    sgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfcnidsavllpevwvgrscrlrrc
    vidracvipegmvigenaeedarrfyrseegivlvtremlrklghkqe
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5l6sI (I:)
    mvslekndhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsn
    cinsgirrmgvitqyqshtlvqhiqrgwsffneemnefvdllpaqqrmkgenwyrgtada
    vtqnldiirrykaeyvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgv
    mavdendkiiefvekpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdf
    gkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmy
    drnwpirtyneslppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfc
    nidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtre
    mlrklghkqer
    

    Sequence, based on observed residues (ATOM records):
    >5l6sI (I:)
    rqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsncinsgirrmgvit
    qqshtlvqhiqrgwsffneemnefvdllpaqqrgtadavtqnldiirrykaeyvvilagd
    hiykqdysrmlidhvekgarctvacmpvpieeasafgvmavdendkiiefvekpanppsm
    pndpskslasmgiyvfdadylyelleeddrdensshdfgkdlipkiteaglayahpfpls
    cvqsdpdaepywrdvgtleaywkanldlasvvpeldmydrnwpirtyneslppakfvqdr
    sgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfcnidsavllpevwvgrscrlrrc
    vidracvipegmvigenaeedarrfyrseegivlvtremlrklghkqer
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >5l6sJ (J:)
    mvslekndhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsn
    cinsgirrmgvitqyqshtlvqhiqrgwsffneemnefvdllpaqqrmkgenwyrgtada
    vtqnldiirrykaeyvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgv
    mavdendkiiefvekpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdf
    gkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmy
    drnwpirtyneslppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfc
    nidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtre
    mlrklghkqer
    

    Sequence, based on observed residues (ATOM records):
    >5l6sJ (J:)
    qlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsncinsgirrmgvitq
    yqshtlvqhiqrgwsffneemnefvdllpaqgtadavtqnldiirrykaeyvvilagdhi
    ykqdysrmlidhvekgarctvacmpvpieeasafgvmavdendkiiefvekpanppsmpn
    dpskslasmgiyvfdadylyelleeddrdensshdfgkdlipkiteaglayahpfplscv
    qsdpdaepywrdvgtleaywkanldlasvvpeldmydrnwpirtyneslppakfvqdrsg
    shgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfcnidsavllpevwvgrscrlrrcvi
    dracvipegmvigenaeedarrfyrseegivlvtremlrklghkqer
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >5l6sK (K:)
    mvslekndhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsn
    cinsgirrmgvitqyqshtlvqhiqrgwsffneemnefvdllpaqqrmkgenwyrgtada
    vtqnldiirrykaeyvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgv
    mavdendkiiefvekpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdf
    gkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmy
    drnwpirtyneslppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfc
    nidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtre
    mlrklghkqer
    

    Sequence, based on observed residues (ATOM records):
    >5l6sK (K:)
    hlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsncinsgirr
    mgvitqqshtlvqhiqrgwsffneemnefvdllpaqqgtadavtqnldiirrykaeyvvi
    lagdhiykqdysrmlidhvekgarctvacmpvpieeasafgvmavdendkiiefvekpan
    ppsmskslasmgiyvfdadylyelleeddrdensshdfgkdlipkiteaglayahpfpls
    cvqsdpdaepywrdvgtleaywkanldlasvvpeldmydrnwpirtyneslppakfvqdr
    sgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfcnidsavllpevwvgrscrlrrc
    vidracvipegmvigenaeedarrfyrseegivlvtremlrklghkqer
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5l6sL (L:)
    mvslekndhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsn
    cinsgirrmgvitqyqshtlvqhiqrgwsffneemnefvdllpaqqrmkgenwyrgtada
    vtqnldiirrykaeyvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgv
    mavdendkiiefvekpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdf
    gkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmy
    drnwpirtyneslppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfc
    nidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtre
    mlrklghkqer
    

    Sequence, based on observed residues (ATOM records):
    >5l6sL (L:)
    dhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsncinsgir
    rmgvitqyqshtlvqhiqrgwsffneemnefvdllpwyrgtadavtqnldiirrykaeyv
    vilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgvmavdendkiiefvekp
    anppsmpndpskslasmgiyvfdadylyelleeddrdensshdfgkdlipkiteaglaya
    hpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmydrnwpirtyneslppa
    kfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfcnidsavllpevwvgrs
    crlrrcvidracvipegmvigenaeedarrfyrseegivlvtremlrklghkqer
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >5l6sM (M:)
    mvslekndhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsn
    cinsgirrmgvitqyqshtlvqhiqrgwsffneemnefvdllpaqqrmkgenwyrgtada
    vtqnldiirrykaeyvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgv
    mavdendkiiefvekpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdf
    gkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmy
    drnwpirtyneslppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfc
    nidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtre
    mlrklghkqer
    

    Sequence, based on observed residues (ATOM records):
    >5l6sM (M:)
    iidfalsncinsgirrmgvhtlvqhiqrgwsffneemnefvdlqnldiirrykaeyvvil
    agdhiykqdysrmlwrdvgtleaywkanldlasvvpeldmydrnwpirtyneslppakfv
    qdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfcnidsavllpevwvgrscrl
    rrcvidracvipegmvigenaeedarrfyrseegivlvtremlrklghk
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >5l6sN (N:)
    mvslekndhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsn
    cinsgirrmgvitqyqshtlvqhiqrgwsffneemnefvdllpaqqrmkgenwyrgtada
    vtqnldiirrykaeyvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgv
    mavdendkiiefvekpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdf
    gkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmy
    drnwpirtyneslppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfc
    nidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtre
    mlrklghkqer
    

    Sequence, based on observed residues (ATOM records):
    >5l6sN (N:)
    rqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsncinsgirrmgvit
    qshtlvqhiqrgwsffneemnefvdllpgtadavtqnldiirrykaeyvvilagdhiykq
    dysrmlidhvekgarctvacvmavdendkiiefasmgiyvfdadylyelleeddrdenss
    hdfgkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpel
    dmydrnwpirtyneslppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvn
    sfcnidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlv
    tremlrklg
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >5l6sO (O:)
    mvslekndhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsn
    cinsgirrmgvitqyqshtlvqhiqrgwsffneemnefvdllpaqqrmkgenwyrgtada
    vtqnldiirrykaeyvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgv
    mavdendkiiefvekpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdf
    gkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmy
    drnwpirtyneslppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfc
    nidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtre
    mlrklghkqer
    

    Sequence, based on observed residues (ATOM records):
    >5l6sO (O:)
    rqlplksvalilalkdltnrakpavhfggkfriidfalsncinsgirrmgvitqshtlvq
    hiqrgwsffneemnefvdlnldiirrykaeyvvilagdhiykqdysrmlidhvekgarct
    vacmpvpieeasafgvmavefvekpanppsmpndpskslasmgiyvfdadylyelleedd
    dfgkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeld
    mydrnwpirtyneslppakfvqdgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfc
    nidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtre
    mlrk
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >5l6sP (P:)
    mvslekndhlmlarqlplksvalilaggrgtrlkdltnkrakpavhfggkfriidfalsn
    cinsgirrmgvitqyqshtlvqhiqrgwsffneemnefvdllpaqqrmkgenwyrgtada
    vtqnldiirrykaeyvvilagdhiykqdysrmlidhvekgarctvacmpvpieeasafgv
    mavdendkiiefvekpanppsmpndpskslasmgiyvfdadylyelleeddrdensshdf
    gkdlipkiteaglayahpfplscvqsdpdaepywrdvgtleaywkanldlasvvpeldmy
    drnwpirtyneslppakfvqdrsgshgmtlnslvsggcvisgsvvvqsvlfsrvrvnsfc
    nidsavllpevwvgrscrlrrcvidracvipegmvigenaeedarrfyrseegivlvtre
    mlrklghkqer
    

    Sequence, based on observed residues (ATOM records):
    >5l6sP (P:)
    alilakdltnkrakpavhfggkfriidfalsncinsgirrmgvithtlvqhiqrgwsffn
    eemnefvdllprgtadavtqnldiirrykaeyvvilagdhiykqdysrmlidhvekgarc
    tvacmpvpieeasafasmgiyvfdadylyelleeddrdensshdfgkdlipkiteagpda
    epywrdvgtleaywkanldlasvvpeldmydrnwpirtyneslppakfvqdrsgshgmtl
    nslvsggcvisgsvvvqsvlfsrvrvnsfcnidsavllpevwvgrscrlrrcvidracvi
    pegmvigenaeedarrfyrseegivlvtremlrklghkq