PDB entry 5l6p

View 5l6p on RCSB PDB site
Description: EphB3 kinase domain covalently bound to an irreversible inhibitor (compound 6)
Class: transferase
Keywords: Kinase, Irreversible Inhibitor, Quinazoline, Signaling, transferase
Deposited on 2016-05-30, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-B receptor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHB3, ETK2, HEK2, TYRO6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54753
      • engineered mutation (286)
    Domains in SCOPe 2.07: d5l6pa_
  • Heterogens: 6P8, DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l6pA (A:)
    gssdpneavrefakeidvscvkieevigagefgevcrgrlkqpgrrevfvaiktlkvgyt
    erqrrdflseasimgqfdhpniirlegvvtksrpvmiltefmencaldsflrlndgqftv
    iqlvgmlrgiaagmkylsemnyvhrdlaarnilvnsnlvckvsdfglsrfleddpsdpty
    tsslggkipirwtapeaiayrkftsasdvwsygivmwevmsygerpywdmsnqdvinave
    qdyrlpppmdcptalhqlmldcwvrdrnlrpkfsqivntldklirnpaslkviasaqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l6pA (A:)
    cvkieevigagefgevcrgrlkqpgrrevfvaiktlkvgyterqrrdflseasimgqfdh
    pniirlegvvtksrpvmiltefmencaldsflrlndgqftviqlvgmlrgiaagmkylse
    mnyvhrdlaarnilvnsnlvckvsdfglsrfleddpsdptytsslggkipirwtapeaia
    yrkftsasdvwsygivmwevmsygerpywdmsnqdvinaveqdyrlpppmdcptalhqlm
    ldcwvrdrnlrpkfsqivntldklirnpaslkvi