PDB entry 5l5n

View 5l5n on RCSB PDB site
Description: plexin a4 full extracellular region, domains 1 to 7 modeled, data to 8.5 angstrom, spacegroup p4(3)22
Deposited on 2016-05-28, released 2016-07-06
The last revision was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 8.5 Å
R-factor: N/A
AEROSPACI score: -0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plexin-A4
    Species: Mus musculus [TaxId:10090]
    Gene: Plxna4, Kiaa1550
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l5nA (A:)
    etgkpsfvtfrgepaegfnhlvvdertghiylgavnriyklssdlkvlvthqtgpdednp
    kcypprivqtcneplastnnvnkmllidykenrliacgslyqgickllrledlfklgepf
    hkkehylsgvnesgsvfgvivsysnfddklfiatavdgkpeyfptissrkltknseadgm
    fayvfhdefvasmikipsdtftvipdfdiyyvygfssgnfvyfltlqpemvsppgsttke
    qvytsklvrlckedtafnsyvevpigcerngveyrllqaaylskagavlgrtlgvrpddd
    llftvfskgqkrkmksldesalcifilkqindrikdrlqscyrgegtldlawlkvkdipc
    ssalltiddnfcgldmnaplgvsemvrgipvftedrdrmtsviayvyknhslafvgtksg
    klkkirvdgpkgnalqyetvqvvdsgpvlrdmafskdheqlyimserqltrvpvescgqy
    rscgeclgsgdphcgwcvlhntctrkercersreprrfasemkqcvrltvhpnnisvsqy
    nvllvletynvpelsagvnctfedlsemdglvignqiqcyspaakevpriitengdhhvv
    qlqlksketgmtfastsfvfyncsvhnsclscvespyrchwckyrhvcthdpntcsfqeg
    rvklpedcpqllrvdkilvpvevikpitlkaknlpqpqsgqrgyecilniqgieqrvpal
    rfnsssvqcqntsysyegmeinnlpveltvvwnghfnidnpaqnkvylykcgamrescgl
    clkadpdfecgwcqspgqctlrqhcpahesrwlelsganskctnpriteiipvtgpregg
    tkvtirgenlglefrdiashvkvagvecsplvdgyipaeqivcemgeakpsqhagfveic
    vavcrpefmarssqlyyfmtltladlkpnrgpmsggtqvtitgtnlnagsnvvvmfgsqp
    clfhrrspsyiicnttsseevldmkvtvqvdrarirqdlvfqyvedptivriepewsivs
    gntpiavwgthldliqnpqirakhggkehinicevlnatemtcqapalalgpdhqsdlte
    rpeefgfildnvqsllilnktnftyypnpvfeafspsgilelkpgtpiilkgknlippva
    ggnvklnytvlvgekpctvtvsdvqllcespnligrhkvmarvggmeyspgmvyiapgrt
    khhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5l5nA (A:)
    psfvtfrgepaegfnhlvvdertghiylgavnriyklssdlkvlvthqtgpdednpkcyp
    privqtcneplastnnvnkmllidykenrliacgslyqgickllrledlfklgepfhkke
    hylsgvnesgsvfgvivsysnfddklfiatavdgkpeyfptissrkltknseadgmfayv
    fhdefvasmikipsdtftvipdfdiyyvygfssgnfvyfltlqpemvsppgsttkeqvyt
    sklvrlckedtafnsyvevpigcerngveyrllqaaylskagavlgrtlgvrpdddllft
    vfskgqkrkmksldesalcifilkqindrikdrlqscyrgegtldlawlkvkdipcssal
    ltiddnfcgldmnaplgvsemvrgipvftedrdrmtsviayvyknhslafvgtksgklkk
    irvdgpkgnalqyetvqvvdsgpvlrdmafskdheqlyimserqltrvpvescgqyrscg
    eclgsgdphcgwcvlhntctrkercersreprrfasemkqcvrltvhpnnisvsqynvll
    vletynvpelsagvnctfedlsemdglvignqiqcyspaakevpriitengdhhvvqlql
    ksketgmtfastsfvfyncsvhnsclscvespyrchwckyrhvcthdpntcsfqegrvkl
    pedcpqllrvdkilvpvevikpitlkaknlpqpqsgqrgyecilniqgieqrvpalrfns
    ssvqcqntsysyegmeinnlpveltvvwnghfnidnpaqnkvylykcgamrescglclka
    dpdfecgwcqspgqctlrqhcpahesrwlelsganskctnpriteiipvtgpreggtkvt
    irgenlglefrdiashvkvagvecsplvdgyipaeqivcemgeakpsqhagfveicvavc
    rpefmarssqlyyfm