PDB entry 5l59

View 5l59 on RCSB PDB site
Description: plexin a1 full extracellular region, domains 1 to 10, to 6 angstrom, spacegroup p2(1)
Deposited on 2016-05-28, released 2016-07-06
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 6 Å
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plexin-A1
    Species: Mus musculus [TaxId:10090]
    Gene: Plxna1, Kiaa4053
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Plexin-A1
    Species: Mus musculus [TaxId:10090]
    Gene: Plxna1, Kiaa4053
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l59A (A:)
    etgpafrtfvasdwglthlvvheqtgevyvgavnriyklsgnltllrahvtgpvednekc
    ypppsvqscphglgstdnvnklllldyaanrllacgsasqgicqflrlddlfklgephhr
    kehylssvreagsmagvliagppgqgqaklfvgtpidgkseyfptlssrrlmaneedadm
    fgfvyqdefvssqlkipsdtlskfpafdiyyvysfrseqfvyyltlqldtqltspdaage
    hfftskivrlcvndpkfysyvefpigceqagveyrlvqdaylsrpgqalakqlglaedee
    vlftvfaqgqknrvkppkesalclftlraikekikeriqscyrgegklslpwllnkelgc
    insplqidddfcgqdfnqplggtvtiegtplfvdkedgltavaaydyqgrtvvfagtrsg
    rirkilvdlanpsgrpalayesvvaqegnpilrdlvlspnrqylyamtekqvtqvpvesc
    vqytscelclgsrdphcgwcvlhsicsrqdaceraeepqrfasdllqcvqltvqprnvsv
    tmsqvplvlqawnvpdlsagvncsfedftetesiledgrihchspsarevapitqgqgdq
    rvvklylksketgkkfasvdfvfyncsvhqsclacvngsfpchwckyrhvctnnaadcaf
    legrvnmsedcpqilpsthiyvpvgvvkpitlaarnlpqpqsgqrgyeclfhipgsparv
    talrfnssslqcqnssysyegndvsdlpvnlsvvwngnfvidnpqniqahlykcpalrqs
    cglclkadprfecgwcvaerrcslrhhcpadspaswmhahhgssrctdpkilklspetgp
    rqggtrltitgenlglrfedvrlgvhvgkvlcspveseyisaeqivceigdastlrahda
    lvevcvrdcslhyralspkrftfvtptfyrvspsrgplsggtwigiegshlnagsdvavs
    iggrpcsfswrnsreircltppghtpgsapivininraqlsnpevkynytedptilridp
    ewsinsggtlltvtgtnlatvreprirakyggierenscmvyndttmvcrapsidnpkrs
    ppelgerpdeigfimdnvrtllvlnsssflyypdpvleplsptgllelkpssplilkgrn
    llppapgnsrlnytvligstpciltvsetqllceapnltgqhkvtvraggfefspgmlqv
    ysdrtkhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5l59A (A:)
    pafrtfvasdwglthlvvheqtgevyvgavnriyklsgnltllrahvtgpvednekcypp
    psvqscphglgstdnvnklllldyaanrllacgsasqgicqflrlddlfklgephhrkeh
    ylssvreagsmagvliagppgqgqaklfvgtpidgkseyfptlssrrlmaneedadmfgf
    vyqdefvssqlkipsdtlskfpafdiyyvysfrseqfvyyltlqldtqlagehfftskiv
    rlcvndpkfysyvefpigceqagveyrlvqdaylsrpgqalakqlglaedeevlftvfaq
    gqknrvkppkesalclftlraikekikeriqscyrgegklslpwllnkelgcinsplqid
    ddfcgqdfnqplggtvtiegtplfvdkedgltavaaydyqgrtvvfagtrsgrirkilvd
    lanpsgrpalayesvvaqegnpilrdlvlspnrqylyamtekqvtqvpvescvqytscel
    clgsrdphcgwcvlhsicsrqdaceraeepqrfasdllqcvqltvqprnvsvtmsqvplv
    lqawnvpdlsagvncsfedftetesiledgrihchspsarevapitqgqgdqrvvklylk
    sketgkkfasvdfvfyncsvhqsclacvngsfpchwckyrhvctnnaadcaflegrvnms
    edcpqilpsthiyvpvgvvkpitlaarnlpqpqsgqrgyeclfhipgsparvtalrfnss
    slqcqnssysyegndvsdlpvnlsvvwngnfvidnpqniqahlykcpalrqscglclkad
    prfecgwcvaerrcslrhhcpadspaswmhahhgssrctdpkilklspetgprqggtrlt
    itgenlglrfedvrlgvhvgkvlcspveseyisaeqivceigdastlrahdalvevcvrd
    cslhyralspkrftfvtptfyrvspsrgplsggtwigiegshlnagsdvavsiggrpcsf
    swrnsreircltppghtpgsapivininraqlsnpevkynytedptilridpewsinsgg
    tlltvtgtnlatvreprirakyggierenscmvyndttmvcrapsidnpkrsppelgerp
    deigfimdnvrtllvlnsssflyypdpvleplssplilkgrnllppapgnsrlnytvlig
    stpciltvsetqllceapnkvtvraggfefs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5l59B (B:)
    etgpafrtfvasdwglthlvvheqtgevyvgavnriyklsgnltllrahvtgpvednekc
    ypppsvqscphglgstdnvnklllldyaanrllacgsasqgicqflrlddlfklgephhr
    kehylssvreagsmagvliagppgqgqaklfvgtpidgkseyfptlssrrlmaneedadm
    fgfvyqdefvssqlkipsdtlskfpafdiyyvysfrseqfvyyltlqldtqltspdaage
    hfftskivrlcvndpkfysyvefpigceqagveyrlvqdaylsrpgqalakqlglaedee
    vlftvfaqgqknrvkppkesalclftlraikekikeriqscyrgegklslpwllnkelgc
    insplqidddfcgqdfnqplggtvtiegtplfvdkedgltavaaydyqgrtvvfagtrsg
    rirkilvdlanpsgrpalayesvvaqegnpilrdlvlspnrqylyamtekqvtqvpvesc
    vqytscelclgsrdphcgwcvlhsicsrqdaceraeepqrfasdllqcvqltvqprnvsv
    tmsqvplvlqawnvpdlsagvncsfedftetesiledgrihchspsarevapitqgqgdq
    rvvklylksketgkkfasvdfvfyncsvhqsclacvngsfpchwckyrhvctnnaadcaf
    legrvnmsedcpqilpsthiyvpvgvvkpitlaarnlpqpqsgqrgyeclfhipgsparv
    talrfnssslqcqnssysyegndvsdlpvnlsvvwngnfvidnpqniqahlykcpalrqs
    cglclkadprfecgwcvaerrcslrhhcpadspaswmhahhgssrctdpkilklspetgp
    rqggtrltitgenlglrfedvrlgvhvgkvlcspveseyisaeqivceigdastlrahda
    lvevcvrdcslhyralspkrftfvtptfyrvspsrgplsggtwigiegshlnagsdvavs
    iggrpcsfswrnsreircltppghtpgsapivininraqlsnpevkynytedptilridp
    ewsinsggtlltvtgtnlatvreprirakyggierenscmvyndttmvcrapsidnpkrs
    ppelgerpdeigfimdnvrtllvlnsssflyypdpvleplsptgllelkpssplilkgrn
    llppapgnsrlnytvligstpciltvsetqllceapnltgqhkvtvraggfefspgmlqv
    ysdrtkhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5l59B (B:)
    pafrtfvasdwglthlvvheqtgevyvgavnriyklsgnltllrahvtgpvednekcypp
    psvqscphglgstdnvnklllldyaanrllacgsasqgicqflrlddlfklgephhrkeh
    ylssvreagsmagvliagppgqgqaklfvgtpidgkseyfptlssrrlmaneedadmfgf
    vyqdefvssqlkipsdtlskfpafdiyyvysfrseqfvyyltlqldtqlagehfftskiv
    rlcvndpkfysyvefpigceqagveyrlvqdaylsrpgqalakqlglaedeevlftvfaq
    gqknrvkppkesalclftlraikekikeriqscyrgegklslpwllnkelgcinsplqid
    ddfcgqdfnqplggtvtiegtplfvdkedgltavaaydyqgrtvvfagtrsgrirkilvd
    lanpsgrpalayesvvaqegnpilrdlvlspnrqylyamtekqvtqvpvescvqytscel
    clgsrdphcgwcvlhsicsrqdaceraeepqrfasdllqcvqltvqprnvsvtmsqvplv
    lqawnvpdlsagvncsfedftetesiledgrihchspsarevapitqgqgdqrvvklylk
    sketgkkfasvdfvfyncsvhqsclacvngsfpchwckyrhvctnnaadcaflegrvnms
    edcpqilpsthiyvpvgvvkpitlaarnlpqpqsgqrgyeclfhipgsparvtalrfnss
    slqcqnssysyegndvsdlpvnlsvvwngnfvidnpqniqahlykcpalrqscglclkad
    prfecgwcvaerrcslrhhcpadspaswmhahhgssrctdpkilklspetgprqggtrlt
    itgenlglrfedvrlgvhvgkvlcspveseyisaeqivceigdastlrahdalvevcvrd
    cslhyralspkrftfvtptfyrvspsrgplsggtwigiegshlnagsdvavsiggrpcsf
    swrnsreircltppghtpgsapivininraqlsnpevkynytedptilridpewsinsgg
    tlltvtgtnlatvreprirakyggierenscmvyndttmvcrapsidnpkrsppelgerp
    deigfimdnvrtllvlnsssflyypdpvleplssplilkgrnllppapgnsrlnytvlig
    stpciltvsetqllceapnkvtvraggfefs