PDB entry 5l57

View 5l57 on RCSB PDB site
Description: Crystal structure of Iso-citrate Dehydrogenase R132H in complex with a novel inhibitor (compound 13a)
Class: oxidoreductase
Keywords: R132H, Iso-citrate Dehydrogenase, Allosteric, oxidoreductase
Deposited on 2016-05-28, released 2016-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase [nadp] cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: IDH1, PICD
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75874 (Start-413)
      • engineered mutation (79-80)
      • engineered mutation (131)
      • engineered mutation (239)
      • engineered mutation (241-242)
    Domains in SCOPe 2.07: d5l57a_
  • Heterogens: NDP, 6N3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l57A (A:)
    mskkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkda
    aeaikkhnvgvkcatitpdaarveefklkqmwkspngtirnilggtvfreaiickniprl
    vsgwvkpiiighhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvam
    gmynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfa
    aaaiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdg
    ktveaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanale
    evsietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l57A (A:)
    kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
    aikkhnvgvkcatitpdaarveefklkqmwkspngtirnilggtvfreaiickniprlvs
    gwvkpiiighhaygdqyratdfvvpgpgkveitytpsdgttylvhnfeegggvamgmynq
    dksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfaaaaiw
    yehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgktvea
    eaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleevsie
    tieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl