PDB entry 5l53

View 5l53 on RCSB PDB site
Description: Menthone neomenthol reductase from Mentha piperita in complex with NADP
Class: oxidoreductase
Keywords: short-chain dehydrogenase/reductases (SDR), Rossmann fold, Menthone, Isomenthone, oxidoreductase
Deposited on 2016-05-27, released 2016-08-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-31, with a file datestamp of 2016-08-24.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (-)-menthone:(+)-neomenthol reductase
    Species: Mentha piperita [TaxId:34256]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5l53a_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l53A (A:)
    gamgdevvvdhaatkryavvtgankgigfeickqlaskgitvilasrdekrgiearerli
    kelgsefgdyvvsqqldvadpasvaalvdfiktkfgsldilvnnaglngtymegdasvln
    dyveaefktfqsgaaktepyhpkatgrlvetvehakecietnyygskrvtealipllqqs
    dsprivnvsstlsslvfqtnewakgvfsseeglteekleevlaeflkdfidgkqqekqwp
    phfsaykvskaalnaytriiakkypsfrinavcpgytktdlsyghgqftdaeaaeapvkl
    allpqggpsgcfffrdeafclyle
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l53A (A:)
    atkryavvtgankgigfeickqlaskgitvilasrdekrgiearerlikelgsefgdyvv
    sqqldvadpasvaalvdfiktkfgsldilvnnaglngtymegdasvlndyveaefktfqs
    gaaktepyhpkatgrlvetvehakecietnyygskrvtealipllqqsdsprivnvsstl
    sslvfqtnewakgvfsseeglteekleevlaeflkdfidgkqqekqwpphfsaykvskaa
    lnaytriiakkypsfrinavcptdaeaaeapvklallpqggpsgcfffrdeafc