PDB entry 5l51

View 5l51 on RCSB PDB site
Description: Menthone neomenthol reductase from Mentha piperita
Class: oxidoreductase
Keywords: short-chain dehydrogenase/reductases (SDR), Rossmann fold, Menthone, Isomenthone, oxidoreductase
Deposited on 2016-05-27, released 2016-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (-)-menthone:(+)-neomenthol reductase
    Species: Mentha piperita [TaxId:34256]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5l51a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l51A (A:)
    gamgdevvvdhaatkryavvtgankgigfeickqlaskgitvilasrdekrgiearerli
    kelgsefgdyvvsqqldvadpasvaalvdfiktkfgsldilvnnaglngtymegdasvln
    dyveaefktfqsgaaktepyhpkatgrlvetvehakecietnyygskrvtealipllqqs
    dsprivnvsstlsslvfqtnewakgvfsseeglteekleevlaeflkdfidgkqqekqwp
    phfsaykvskaalnaytriiakkypsfrinavcpgytktdlsyghgqftdaeaaeapvkl
    allpqggpsgcfffrdeafclyle
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l51A (A:)
    atkryavvtgankgigfeickqlaskgitvilasrdekrgiearerlikelgsefgdyvv
    sqqldvadpasvaalvdfiktkfgsldilvnnaglngtymegdasvlndyveaefktfqs
    gaaktepyhpkatgrlvetvehakecietnyygskrvtealipllqqsdsprivnvsstl
    sslvfqtnewakgvfsseeglteekleevlaeflkdfidgkqqekqwpphfsaykvskaa
    lnaytriiakkypsfrinavcptdaeaaeapvklallpqggpsgcfffrde