PDB entry 5l4x

View 5l4x on RCSB PDB site
Description: Crystal structure of FimH lectin domain in complex with 4-Deoxy-Heptylmannoside
Class: sugar binding protein
Keywords: FimH, Type 1 pilus, urinary tract infection, UTI, carbohydrate, lectin, mannose, cell adhesion, sugar binding protein
Deposited on 2016-05-26, released 2017-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein fimh
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5l4xa_
  • Chain 'B':
    Compound: protein fimh
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5l4xb_
  • Heterogens: 6KU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l4xA (A:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l4xB (B:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt