PDB entry 5l3m

View 5l3m on RCSB PDB site
Description: D11 bound [S39_PQ]-IGF-II
Class: cell cycle
Keywords: IGF-II, cell cycle
Deposited on 2016-05-23, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin-like growth factor II
  Species: Homo sapiens [TaxId:9606]
  Gene: IGF2, PP1446
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01344 (0-68)
    • insertion (39-40)
  Domains in SCOPe 2.07: d5l3ma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5l3mA (A:)
  ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrspqrgiveeccfrscdlallet
  ycatpakse