PDB entry 5l3l

View 5l3l on RCSB PDB site
Description: D11 bound IGF-II
Class: cell cycle
Keywords: IGF-II, cell cycle
Deposited on 2016-05-23, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin-like growth factor II
    Species: Homo sapiens [TaxId:9606]
    Gene: IGF2, PP1446
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5l3la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5l3lA (A:)
ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc
atpakse