PDB entry 5l33

View 5l33 on RCSB PDB site
Description: crystal structure of a de novo designed protein with curved beta-sheet
Deposited on 2016-08-03, released 2017-01-25
The last revision was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: denovo NTF2
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5L33 (Start-107)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l33A (A:)
    gshmpeeekaarlfiealekgdpelmrkvispdtrmedngreftgdevveyvkeiqkrge
    qwhlrrytkegnswrfevqvdnngqteqwevqievrngrikrvtithv
    

    Sequence, based on observed residues (ATOM records):
    >5l33A (A:)
    hmpeeekaarlfiealekgdpelmrkvispdtrmedngreftgdevveyvkeiqkrgeqw
    hlrrytkegnswrfevqvdnngqteqwevqievrngrikrvtithv