PDB entry 5l32

View 5l32 on RCSB PDB site
Description: Crystal structure of the Zn-RIDC1 complex bearing six interfacial disulfide bonds
Class: metal binding protein
Keywords: protein engineering, metalloprotein, cytochrome, disulfide bonding, METAL BINDING PROTEIN
Deposited on 2016-08-02, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (80)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d5l32a_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (80)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d5l32b_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (80)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d5l32c_
  • Chain 'D':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (80)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d5l32d_
  • Heterogens: HEM, P6G, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l32A (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppkledkspdspemhd
    frhgfwiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l32B (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppkledkspdspemhd
    frhgfwiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l32C (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppkledkspdspemhd
    frhgfwiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l32D (D:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppkledkspdspemhd
    frhgfwiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr