PDB entry 5l31

View 5l31 on RCSB PDB site
Description: Crystal structure of an engineered metal-free RIDC1 variant containing five disulfide bonds.
Class: electron transport
Keywords: engineered protein, cytochrome, complex, ELECTRON TRANSPORT
Deposited on 2016-08-02, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (80)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d5l31a_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (80)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d5l31b_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (80)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d5l31c_
  • Chain 'D':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (80)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d5l31d_
  • Heterogens: HEM, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l31A (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppkledkspdspemhd
    frhgfwiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l31B (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppkledkspdspemhd
    frhgfwiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5l31C (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppkledkspdspemhd
    frhgfwiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l31C (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppspdspemhdfrhgf
    wiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l31D (D:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppkledkspdspemhd
    frhgfwiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr