PDB entry 5l2v

View 5l2v on RCSB PDB site
Description: Catalytic domain of LPMO Lmo2467 from Listeria monocytogenes
Class: chitin-binding protein
Keywords: Lytic polysaccharide monooxygenase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, CHITIN-BINDING PROTEIN
Deposited on 2016-08-02, released 2017-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chitin-binding protein
    Species: Listeria monocytogenes serotype 1/2a (strain 10403S) [TaxId:393133]
    Gene: LMRG_01781
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5l2va_
  • Chain 'B':
    Compound: Chitin-binding protein
    Species: Listeria monocytogenes serotype 1/2a (strain 10403S) [TaxId:393133]
    Gene: LMRG_01781
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5l2vb_
  • Heterogens: CU, P33, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5l2vA (A:)
hgyiskpasrvylankginvgvgsaqyepqsveapkgfpisgpadgsiagggkyslldeq
sasrwakvdiesgpltvewtltaphktsswqyfitkkgwdpnkpltrssleplatieadg
svpnalakqeinipndrsgyylilgvwniadtgnafyqvidaniin

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5l2vB (B:)
hgyiskpasrvylankginvgvgsaqyepqsveapkgfpisgpadgsiagggkyslldeq
sasrwakvdiesgpltvewtltaphktsswqyfitkkgwdpnkpltrssleplatieadg
svpnalakqeinipndrsgyylilgvwniadtgnafyqvidaniin