PDB entry 5l2m

View 5l2m on RCSB PDB site
Description: Structure of ALDH1A1 in complex with BUC11
Class: oxidoreductase/oxidoreductase inihbitor
Keywords: ALDH1A1 Inhibitor, OXIDOREDUCTASE-OXIDOREDUCTASE INIHBITOR complex
Deposited on 2016-08-02, released 2017-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinal dehydrogenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH1A1, ALDC, ALDH1, PUMB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5l2ma_
  • Heterogens: YB, 6ZY, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l2mA (A:)
    msssgtpdlpvlltdlkiqytkifinnewhdsvsgkkfpvfnpateeelcqveegdkedv
    dkavkaarqafqigspwrtmdasergrllykladlierdrlllatmesmnggklysnayl
    ndlagciktlrycagwadkiqgrtipidgnfftytrhepigvcgqiipwnfplvmliwki
    gpalscgntvvvkpaeqtpltalhvaslikeagfppgvvnivpgygptagaaisshmdid
    kvaftgstevgklikeaagksnlkrvtlelggkspcivladadldnavefahhgvfyhqg
    qcciaasrifveesiydefvrrsverakkyilgnpltpgvtqgpqidkeqydkildlies
    gkkegaklecgggpwgnkgyfvqptvfsnvtdemriakeeifgpvqqimkfkslddvikr
    anntfyglsagvftkdidkaitissalqagtvwvncygvvsaqcpfggfkmsgngrelge
    ygfheytevktvtvkisqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l2mA (A:)
    dlpvlltdlkiqytkifinnewhdsvsgkkfpvfnpateeelcqveegdkedvdkavkaa
    rqafqigspwrtmdasergrllykladlierdrlllatmesmnggklysnaylndlagci
    ktlrycagwadkiqgrtipidgnfftytrhepigvcgqiipwnfplvmliwkigpalscg
    ntvvvkpaeqtpltalhvaslikeagfppgvvnivpgygptagaaisshmdidkvaftgs
    tevgklikeaagksnlkrvtlelggkspcivladadldnavefahhgvfyhqgqcciaas
    rifveesiydefvrrsverakkyilgnpltpgvtqgpqidkeqydkildliesgkkegak
    lecgggpwgnkgyfvqptvfsnvtdemriakeeifgpvqqimkfkslddvikranntfyg
    lsagvftkdidkaitissalqagtvwvncygvvsaqcpfggfkmsgngrelgeygfheyt
    evktvtvkisqkns