PDB entry 5l2i

View 5l2i on RCSB PDB site
Description: The X-ray co-crystal structure of human CDK6 and Palbociclib.
Class: Transferase/Transferase Inhibitor
Keywords: cyclin-dependent kinase, kinase inhibitor, kinase selectivity, Transferase-Transferase Inhibitor complex
Deposited on 2016-08-01, released 2016-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK6, CDKN6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5l2ia_
  • Heterogens: LQQ

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l2iA (A:)
    mekdglcradqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstir
    evavlrhletfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvpte
    tikdmmfqllrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvv
    vtlwyrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpge
    edwprdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyf
    qhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l2iA (A:)
    dqqyecvaeigegaygkvfkardlknggrfvalkrvrplstirevavlrhletfehpnvv
    rlfdvctkltlvfehvdqdlttyldkvpepgvptetikdmmfqllrgldflhshrvvhrd
    lkpqnilvtssgqikladfglvtlwyrapevllqssyatpvdlwsvgcifaemfrrkplf
    rgssdvdqlgkildviglpgeedwprdvalprqafksaqpiekfvtdidelgkdlllkcl
    tfnpakrisaysalshpyfq