PDB entry 5l2b

View 5l2b on RCSB PDB site
Description: structure of cntnw n149s, e332a in an outward-facing state
Deposited on 2016-07-31, released 2017-04-12
The last revision was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside permease
    Species: Neisseria wadsworthii 9715 [TaxId:1030841]
    Gene: nupC, HMPREF9370_1765
    Database cross-references and differences (RAF-indexed):
    • Uniprot G4CRQ5 (6-End)
      • expression tag (4-5)
      • engineered mutation (154)
      • engineered mutation (337)
  • Chain 'B':
    Compound: Nucleoside permease
    Species: Neisseria wadsworthii 9715 [TaxId:1030841]
    Gene: nupC, HMPREF9370_1765
    Database cross-references and differences (RAF-indexed):
    • Uniprot G4CRQ5 (6-End)
      • expression tag (5)
      • engineered mutation (154)
      • engineered mutation (337)
  • Chain 'C':
    Compound: Nucleoside permease
    Species: Neisseria wadsworthii 9715 [TaxId:1030841]
    Gene: nupC, HMPREF9370_1765
    Database cross-references and differences (RAF-indexed):
    • Uniprot G4CRQ5
      • engineered mutation (154)
      • engineered mutation (337)
  • Heterogens: 6ZL

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l2bA (A:)
    gpavprmvvlhsllgmavliaiavllstdrkainirtvagafliqvalgalvlyvpqgrd
    mlgeasktisnviaygnngvdflfgglvsekmfevfggggfvfalrvlpmivffsslmav
    lyyigvmqllikviggflqkmlgtskaesmsaaasifvgqteaplvvrpyirrmteself
    avmsgglasvagsvlagyvqmgvplpyliaasfmaapggllfakllvpetertqndaevl
    aenedekptnvidaaasgavtgaqiaiavgasllafvaliamingiiggvggwfghgdlt
    lqailgwlfsplawvigvpwseagiagsligqkvvinafvaysefvkylkpeaavqlsdt
    tkaiisfalcgfanlgsiavlvgglsimapkrrkdvarlgikavvagslsnlmsaviagl
    ftglsgasvlg
    

    Sequence, based on observed residues (ATOM records):
    >5l2bA (A:)
    prmvvlhsllgmavliaiavllstdrkainirtvagafliqvalgalvlyvpqgrdmlge
    asktisnviaygnngvdflfgglvsekmfevfggggfvfalrvlpmivffsslmavlyyi
    gvmqllikviggflqkmlgtskaesmsaaasifvgqteaplvvrpyirrmteselfavms
    gglasvagsvlagyvqmgvplpyliaasfmaapggllfakllvpetertqndaevlaene
    dekptnvidaaasgavtgaqiaiavgasllafvaliamingiiggvggwfghgdltlqai
    lgwlfsplawvigvpwseagiagsligqkvvinafvaysefvkylkpeaavqlsdttkai
    isfalcgfanlgsiavlvgglsimapkrrkdvarlgikavvagslsnlmsaviaglftgl
    s
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5l2bB (B:)
    gpavprmvvlhsllgmavliaiavllstdrkainirtvagafliqvalgalvlyvpqgrd
    mlgeasktisnviaygnngvdflfgglvsekmfevfggggfvfalrvlpmivffsslmav
    lyyigvmqllikviggflqkmlgtskaesmsaaasifvgqteaplvvrpyirrmteself
    avmsgglasvagsvlagyvqmgvplpyliaasfmaapggllfakllvpetertqndaevl
    aenedekptnvidaaasgavtgaqiaiavgasllafvaliamingiiggvggwfghgdlt
    lqailgwlfsplawvigvpwseagiagsligqkvvinafvaysefvkylkpeaavqlsdt
    tkaiisfalcgfanlgsiavlvgglsimapkrrkdvarlgikavvagslsnlmsaviagl
    ftglsgasvlg
    

    Sequence, based on observed residues (ATOM records):
    >5l2bB (B:)
    rmvvlhsllgmavliaiavllstdrkainirtvagafliqvalgalvlyvpqgrdmlgea
    sktisnviaygnngvdflfgglvsekmfevfggggfvfalrvlpmivffsslmavlyyig
    vmqllikviggflqkmlgtskaesmsaaasifvgqteaplvvrpyirrmteselfavmsg
    glasvagsvlagyvqmgvplpyliaasfmaapggllfakllvpetertqnkptnvidaaa
    sgavtgaqiaiavgasllafvaliamingiiggvggwfghgdltlqailgwlfsplawvi
    gvpwseagiagsligqkvvinafvaysefvkylkpeaavqlsdttkaiisfalcgfanlg
    siavlvgglsimapkrrkdvarlgikavvagslsnlmsaviaglftglsgasv
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5l2bC (C:)
    gpavprmvvlhsllgmavliaiavllstdrkainirtvagafliqvalgalvlyvpqgrd
    mlgeasktisnviaygnngvdflfgglvsekmfevfggggfvfalrvlpmivffsslmav
    lyyigvmqllikviggflqkmlgtskaesmsaaasifvgqteaplvvrpyirrmteself
    avmsgglasvagsvlagyvqmgvplpyliaasfmaapggllfakllvpetertqndaevl
    aenedekptnvidaaasgavtgaqiaiavgasllafvaliamingiiggvggwfghgdlt
    lqailgwlfsplawvigvpwseagiagsligqkvvinafvaysefvkylkpeaavqlsdt
    tkaiisfalcgfanlgsiavlvgglsimapkrrkdvarlgikavvagslsnlmsaviagl
    ftglsgasvlg
    

    Sequence, based on observed residues (ATOM records):
    >5l2bC (C:)
    vvlhsllgmavliaiavllstdrkainirtvagafliqvalgalvlyvpqgrdmlgeask
    tisnviaygnngvdflfgglvsekmfevfggggfvfalrvlpmivffsslmavlyyigvm
    qllikviggflqkmlgtskaesmsaaasifvgqteaplvvrpyirrmteselfavmsggl
    asvagsvlagyvqmgvplpyliaasfmaapggllfakllvpetertqekptnvidaaasg
    avtgaqiaiavgasllafvaliamingiiggvggwfghgdltlqailgwlfsplawvigv
    pwseagiagsligqkvvinafvaysefvkylkpeaavqlsdttkaiisfalcgfanlgsi
    avlvgglsimapkrrkdvarlgikavvagslsnlmsaviaglftg