PDB entry 5l25

View 5l25 on RCSB PDB site
Description: crystal structure of arabidopsis thaliana bor1
Deposited on 2016-07-31, released 2016-09-14
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 4.11 Å
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Boron transporter 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: BOR1, At2g47160, T3D7.3
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l25A (A:)
    meetfvpfegikndlkgrlmcykqdwtggfkagfrilapttyiffasaipvisfgeqler
    stdgvltavqtlastaicgmihsiiggqpllilgvaeptvimytfmfnfakarpelgrdl
    flawsgwvcvwtalmlfvlaicgacsiinrftrvagelfglliamlfmqqaikglvdefr
    iperenqklkeflpswrfangmfalvlsfgllltglrsrkarswrygtgwlrsliadygv
    plmvlvwtgvsyipagdvpkgiprrlfspnpwspgaygnwtvvkemldvpivyiigafip
    asmiavlyyfdhsvasqlaqqkefnlrkpssyhydllllgfltlmcgllgvppsngvipq
    spmhtkslatlkyqllrnrlvatarrsiktnaslgqlydnmqeayhhmqtplvyqqpqgl
    kelkestiqattftgnlnapvdetlfdiekeiddllpvevkeqrvsnllqstmvggcvaa
    mpilkmiptsvlwgyfafmaieslpgnqfwerilllftapsrrfkvledyhatfvetvpf
    ktiamftlfqttyllicfgltwipiagvmfplmimflipvrqyllprffkgahlqdldaa
    eyeeapalpfnlaaeteigsttsypgdleildevmtrsrgefrhtaaalvpr
    

    Sequence, based on observed residues (ATOM records):
    >5l25A (A:)
    gfrilapttyiffasaipvisfgeqlerstdgvltavqtlastaicgmihslilgvaept
    vimytfmfnfakarpelgrdlflawsgwvcvwtalmlfvlaicgacsiinrftrvagelf
    glliamlfmqqaikglvdefriperenqklkeflpswrfangmfalvlsfgllltglrsr
    karswrygtgwlrsliadygvplmvlvwtgvsyipivyiigafipasmiavlyyfdhsva
    sqlaqqkefdllllgfltlmcgllgsngvipqspmhtkslatvsnllqstmvggcvaamp
    ilktsvlwgyfafmaieslpgnqfwerilllftapsrrfkvlyhatfvetvpfktiamft
    lfqttyllicfgltwipiagvmfplmimflipvrqyllp