PDB entry 5l1o

View 5l1o on RCSB PDB site
Description: X-ray Structure of Cytochrome P450 PntM with Pentalenolactone F
Class: oxidoreductase
Keywords: PntM, cytochrome P450, pentalenolactone F, OXIDOREDUCTASE
Deposited on 2016-07-29, released 2016-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pentalenolactone synthase
    Species: Streptomyces arenae [TaxId:29301]
    Gene: pntM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5l1oa_
  • Heterogens: 7PF, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l1oA (A:)
    gshmtdlprlpfdnpdimgiapqmlalqkegpiarvgtagedawlvtrydevrtlladrr
    lrlsnpnpqpsaksaarafmvalmagddheteparhaqmrslliprfstrrlrlmktrie
    hhvdelldqlaasappvdlhrvlsfrlptmvvcdllgvpladrerfgqwargtfdqsdne
    hsantfqqvvdymlelvarkrvepgddilseliaekdgalsdadiahlgnavllfgyett
    ivridlgtllllrnpvqraqlaedpglapaaveeilrlgvggkgsnalipryahgditvg
    etvirtgdavmlaigaanyddrafpdgglfdltrvrprshlafghgarhcigrtlariel
    tavferlfrrlpdlrlavpeeslrwqehritggfdeipvtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l1oA (A:)
    tdlprlpfdnpdimgiapqmlalqkegpiarvgtagedawlvtrydevrtlladrrlrls
    npnpqpsaksaarafmvalmagddheteparhaqmrslliprfstrrlrlmktriehhvd
    elldqlaasappvdlhrvlsfrlptmvvcdllgvpladrerfgqwargtfdqsdnehsan
    tfqqvvdymlelvarkrvepgddilseliaekdgalsdadiahlgnavllfgyettivri
    dlgtllllrnpvqraqlaedpglapaaveeilrlgvggkgsnalipryahgditvgetvi
    rtgdavmlaigaanyddrafpdgglfdltrvrprshlafghgarhcigrtlarieltavf
    erlfrrlpdlrlavpeeslrwqehritggfdeipvtf