PDB entry 5l1m

View 5l1m on RCSB PDB site
Description: CASKIN2 SAM domain tandem
Class: protein binding
Keywords: signaling protein, protein interaction domain, sterile alpha motif, PROTEIN BINDING
Deposited on 2016-07-29, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caskin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: CASKIN2, KIAA1139
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5l1ma1, d5l1ma2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l1mA (A:)
    gsshhhhhhssglvprgshmasmtggqqgsmgreqllegkdaqaihnwlsefqlegytah
    flqagydvptisrmtpedltaigvtkpghrkkiaseiaqlsiaewlpsyiptdllewlca
    lglpqyhkqlvssgydsmglvadltweelqeigvnklghqkklmlgvkrlaelrrgllqg
    eals
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l1mA (A:)
    gkdaqaihnwlsefqlegytahflqagydvptisrmtpedltaigvtkpghrkkiaseia
    qlsiaewlpsyiptdllewlcalglpqyhkqlvssgydsmglvadltweelqeigvnklg
    hqkklmlgvkrlaelrrgll