PDB entry 5l1j

View 5l1j on RCSB PDB site
Description: crystal structure of human dna polymerase eta inserting dtmpnpp opposite o6-methyl-2'-deoxyguanosine
Deposited on 2016-07-29, released 2016-10-05
The last revision was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA Polymerase ETA
    Species: Homo sapiens [TaxId:9606]
    Gene: POLH, RAD30, RAD30A, XPV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y253 (3-434)
      • expression tag (0-2)
  • Chain 'P':
    Compound: DNA (5'-d(*ap*gp*cp*gp*tp*cp*ap*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'T':
    Compound: DNA (5'-d(*cp*ap*tp*(6og)p*ap*tp*gp*ap*cp*gp*cp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: MG, GOL, 1FZ, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l1jA (A:)
    gphmatgqdrvvalvdmdcffvqveqrqnphlrnkpcavvqykswkgggiiavsyearaf
    gvtrsmwaddakklcpdlllaqvresrgkanltkyreasvevmeimsrfavierasidea
    yvdltsavqerlqklqgqpisadllpstyieglpqgpttaeetvqkegmrkqglfqwlds
    lqidnltspdlqltvgaviveemraaieretgfqcsagishnkvlaklacglnkpnrqtl
    vshgsvpqlfsqmpirkirslggklgasvieilgieymgeltqftesqlqshfgekngsw
    lyamcrgiehdpvkprqlpktigcsknfpgktalatreqvqwwllqlaqeleerltkdrn
    dndrvatqlvvsirvqgdkrlsslrrccaltrydahkmshdaftvikncntsgiqtewsp
    pltmlflcatkfsas
    

    Sequence, based on observed residues (ATOM records):
    >5l1jA (A:)
    gphmatgqdrvvalvdmdcffvqveqrqnphlrnkpcavvqykswkgggiiavsyearaf
    gvtrsmwaddakklcpdlllaqvresrgkanltkyreasvevmeimsrfavierasidea
    yvdltsavqerlqklqgqpisadllpstyieglpqgptvqkegmrkqglfqwldslqidn
    ltspdlqltvgaviveemraaieretgfqcsagishnkvlaklacglnkpnrqtlvshgs
    vpqlfsqmpirkirslggklgasvieilgieymgeltqftesqlqshfgekngswlyamc
    rgiehdpvkprqlpktigcsknfpgktalatreqvqwwllqlaqeleerltkdrndndrv
    atqlvvsirvqgdkrlsslrrccaltrydahkmshdaftvikncntsgiqtewsppltml
    flcatkfsas
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.