PDB entry 5l1e

View 5l1e on RCSB PDB site
Description: ampa subtype ionotropic glutamate receptor glua2 in complex with noncompetitive inhibitor cp465022
Deposited on 2016-07-29, released 2016-10-19
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 4.37 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (0-534)
      • engineered mutation (231)
      • engineered mutation (375)
      • engineered mutation (382)
    • Uniprot P19491
  • Chain 'B':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (0-534)
      • engineered mutation (231)
      • engineered mutation (375)
      • engineered mutation (382)
    • Uniprot P19491
  • Chain 'C':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (0-534)
      • engineered mutation (231)
      • engineered mutation (375)
      • engineered mutation (382)
    • Uniprot P19491
  • Chain 'D':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (0-534)
      • engineered mutation (231)
      • engineered mutation (375)
      • engineered mutation (382)
    • Uniprot P19491
  • Heterogens: NAG, 6ZQ

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l1eA (A:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvlteddtsgleqktvvvttilespyvmmkknhemlegneryegycvdla
    aeiakhcgfkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevi
    dfskpfmslgisimikkpqkskpgvfsfldplayeiwmcivfayigvsvvlflvsdtdst
    nefgifnslwfslgafmqqgadisprslsgrivggvwwfftliiissytanlaafltver
    mvspiesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttae
    gvarvrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnl
    avlklseqgvldklknkwwydkgecgakdsgskektsalslsnvagvfyilvgglglaml
    valiefcyksraeakrmkglvpr
    

    Sequence, based on observed residues (ATOM records):
    >5l1eA (A:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvlteddtsgleqktvvvttilespyvmmkknhemlegneryegycvdla
    aeiakhcgfkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevi
    dfskpfmslgisimikkpqkskpgvfsfldplayeiwmcivfayigvsvvlflvsifnsl
    wfslgafmqqgisprslsgrivggvwwfftliiissytanlaafltvermvspiesaedl
    skqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrkskgk
    yayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlklseqgvl
    dklknkwwydkgecgakdsgskektsalslsnvagvfyilvgglglamlvaliefcy
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5l1eB (B:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvlteddtsgleqktvvvttilespyvmmkknhemlegneryegycvdla
    aeiakhcgfkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevi
    dfskpfmslgisimikkpqkskpgvfsfldplayeiwmcivfayigvsvvlflvsdtdst
    nefgifnslwfslgafmqqgadisprslsgrivggvwwfftliiissytanlaafltver
    mvspiesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttae
    gvarvrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnl
    avlklseqgvldklknkwwydkgecgakdsgskektsalslsnvagvfyilvgglglaml
    valiefcyksraeakrmkglvpr
    

    Sequence, based on observed residues (ATOM records):
    >5l1eB (B:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvlteddtsgleqktvvvttilespyvmmkknhemlegneryegycvdla
    aeiakhcgfkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevi
    dfskpfmslgisimikkpqkskpgvfsfldplayeiwmcivfayigvsvvlflvsifnsl
    wfslgafmqqgslsgrivggvwwfftliiissytanlaafltvermvspiesaedlskqt
    eiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrkskgkyayl
    lestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlklseqgvldklk
    nkwwydkgecgakdsgskektsalslsnvagvfyilvgglglamlvaliefcy
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5l1eC (C:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvlteddtsgleqktvvvttilespyvmmkknhemlegneryegycvdla
    aeiakhcgfkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevi
    dfskpfmslgisimikkpqkskpgvfsfldplayeiwmcivfayigvsvvlflvsdtdst
    nefgifnslwfslgafmqqgadisprslsgrivggvwwfftliiissytanlaafltver
    mvspiesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttae
    gvarvrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnl
    avlklseqgvldklknkwwydkgecgakdsgskektsalslsnvagvfyilvgglglaml
    valiefcyksraeakrmkglvpr
    

    Sequence, based on observed residues (ATOM records):
    >5l1eC (C:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvlteddtsgleqktvvvttilespyvmmkknhemlegneryegycvdla
    aeiakhcgfkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevi
    dfskpfmslgisimikkpqkskpgvfsfldplayeiwmcivfayigvsvvlflvsifnsl
    wfslgafmqqgslsgrivggvwwfftliiissytanlaafltvermvspiesaedlskqt
    eiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrkskgkyayl
    lestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlklseqgvldklk
    nkwwydkgecgakdsgskektsalslsnvagvfyilvgglglamlvaliefcy
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5l1eD (D:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvlteddtsgleqktvvvttilespyvmmkknhemlegneryegycvdla
    aeiakhcgfkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevi
    dfskpfmslgisimikkpqkskpgvfsfldplayeiwmcivfayigvsvvlflvsdtdst
    nefgifnslwfslgafmqqgadisprslsgrivggvwwfftliiissytanlaafltver
    mvspiesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttae
    gvarvrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnl
    avlklseqgvldklknkwwydkgecgakdsgskektsalslsnvagvfyilvgglglaml
    valiefcyksraeakrmkglvpr
    

    Sequence, based on observed residues (ATOM records):
    >5l1eD (D:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvlteddtsgleqktvvvttilespyvmmkknhemlegneryegycvdla
    aeiakhcgfkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevi
    dfskpfmslgisimikkpqkskpgvfsfldplayeiwmcivfayigvsvvlflvsifnsl
    wfslgafmqqgisprslsgrivggvwwfftliiissytanlaafltvermvspiesaedl
    skqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrkskgk
    yayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlklseqgvl
    dklknkwwydkgecgakdsgskektsalslsnvagvfyilvgglglamlvaliefcy