PDB entry 5l1c

View 5l1c on RCSB PDB site
Description: Heteronuclear Solution Structure of Chlorotoxin
Class: toxin
Keywords: scorpion toxin, venom, peptide disulfide rich peptide, TOXIN
Deposited on 2016-07-28, released 2017-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chlorotoxin
    Species: Leiurus quinquestriatus quinquestriatus [TaxId:6885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5l1ca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l1cA (A:)
    mcmpcfttdhqmarkcddccggkgrgkcygpqclcr