PDB entry 5l0y

View 5l0y on RCSB PDB site
Description: crystal structure of a sec72-ssa1 c-terminal peptide fusion protein
Deposited on 2016-07-28, released 2017-03-22
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sec72-ssa1 c-terminal peptide fusion protein
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: CTHT_0068610
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0SH41 (0-146)
      • linker (147)
    • PDB 5L0Y (Start-158)
  • Chain 'B':
    Compound: Sec72-ssa1 c-terminal peptide fusion protein
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: CTHT_0068610
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0SH41 (0-146)
      • linker (147-148)
    • PDB 5L0Y
  • Chain 'C':
    Compound: Sec72-ssa1 c-terminal peptide fusion protein
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: CTHT_0068610
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0SH41 (0-146)
      • linker (147-149)
    • PDB 5L0Y
  • Chain 'D':
    Compound: Sec72-ssa1 c-terminal peptide fusion protein
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: CTHT_0068610
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0SH41 (Start-146)
      • linker (147-149)
    • PDB 5L0Y (Start-158)
  • Chain 'E':
    Compound: Sec72-ssa1 c-terminal peptide fusion protein
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: CTHT_0068610
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0SH41 (Start-146)
      • linker (147)
    • PDB 5L0Y (Start-158)
  • Chain 'F':
    Compound: Sec72-ssa1 c-terminal peptide fusion protein
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: CTHT_0068610
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Sec72-ssa1 c-terminal peptide fusion protein
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: CTHT_0068610
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0SH41 (0-146)
      • linker (147)
    • PDB 5L0Y
  • Chain 'H':
    Compound: Sec72-ssa1 c-terminal peptide fusion protein
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: CTHT_0068610
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: pro-thr-val-glu-glu-val-asp
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed):
    • PDB 5L0Y (Start-6)
  • Chain 'J':
    Compound: pro-thr-val-glu-glu-val-asp
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed):
    • PDB 5L0Y (0-6)
  • Chain 'K':
    Compound: pro-thr-val-glu-glu-val-asp
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed):
    • PDB 5L0Y (0-6)
  • Chain 'L':
    Compound: pro-thr-val-glu-glu-val-asp
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed):
    • PDB 5L0Y (Start-6)
  • Chain 'M':
    Compound: pro-thr-val-glu-glu-val-asp
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed):
    • PDB 5L0Y (Start-6)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l0yA (A:)
    vnpkrsaninklresgnaeyrkqrygdaiklytlglqmaltrpawepaglvrdeihqlys
    nraqaymqlgqwpeaaadaecsveakrqgnakawyrrgkclmemrrlqearewvarglef
    egeekelaellkeidsklaaekasrdahdndgptveevd
    

    Sequence, based on observed residues (ATOM records):
    >5l0yA (A:)
    vnpkrsaninklresgnaeyrkqrygdaiklytlglqmaltrpawepaglvrdeihqlys
    nraqaymqlgqwpeaaadaecsveakrqgnakawyrrgkclmemrrlqearewvarglef
    egeekelaellkeidsklaaekasrdahptveevd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5l0yB (B:)
    vnpkrsaninklresgnaeyrkqrygdaiklytlglqmaltrpawepaglvrdeihqlys
    nraqaymqlgqwpeaaadaecsveakrqgnakawyrrgkclmemrrlqearewvarglef
    egeekelaellkeidsklaaekasrdahdndgptveevd
    

    Sequence, based on observed residues (ATOM records):
    >5l0yB (B:)
    vnpkrsaninklresgnaeyrkqrygdaiklytlglqmaltrpawepaglvrdeihqlys
    nraqaymqlgqwpeaaadaecsveakrqgnakawyrrgkclmemrrlqearewvarglef
    egeekelaellkeidsklaaekasrdahd
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5l0yC (C:)
    vnpkrsaninklresgnaeyrkqrygdaiklytlglqmaltrpawepaglvrdeihqlys
    nraqaymqlgqwpeaaadaecsveakrqgnakawyrrgkclmemrrlqearewvarglef
    egeekelaellkeidsklaaekasrdahdndgptveevd
    

    Sequence, based on observed residues (ATOM records):
    >5l0yC (C:)
    vnpkrsaninklresgnaeyrkqrygdaiklytlglqmaltrpawepaglvrdeihqlys
    nraqaymqlgqwpeaaadaecsveakrqgnakawyrrgkclmemrrlqearewvarglef
    egeekelaellkeidsklaaekasrdahdn
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5l0yD (D:)
    vnpkrsaninklresgnaeyrkqrygdaiklytlglqmaltrpawepaglvrdeihqlys
    nraqaymqlgqwpeaaadaecsveakrqgnakawyrrgkclmemrrlqearewvarglef
    egeekelaellkeidsklaaekasrdahdndgptveevd
    

    Sequence, based on observed residues (ATOM records):
    >5l0yD (D:)
    aninklresgnaeyrkqrygdaiklytlglqmaltrpawepaglvrdeihqlysnraqay
    mqlgqwpeaaadaecsveakrqgnakawyrrgkclmemrrlqearewvarglefeeekel
    aellkeidsklaaekasrdahdnptveevd
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5l0yE (E:)
    vnpkrsaninklresgnaeyrkqrygdaiklytlglqmaltrpawepaglvrdeihqlys
    nraqaymqlgqwpeaaadaecsveakrqgnakawyrrgkclmemrrlqearewvarglef
    egeekelaellkeidsklaaekasrdahdndgptveevd
    

    Sequence, based on observed residues (ATOM records):
    >5l0yE (E:)
    pkrsaninklresgnaeyrkqrygdaiklytlglqmaltrpawepaglvrdeihqlysnr
    aqaymqlgqwpeaaadaecsveakrqgnakawyrrgkclmemrrlqearewvarglefee
    kelaellkeidsklaaekasrdahptveevd
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5l0yF (F:)
    vnpkrsaninklresgnaeyrkqrygdaiklytlglqmaltrpawepaglvrdeihqlys
    nraqaymqlgqwpeaaadaecsveakrqgnakawyrrgkclmemrrlqearewvarglef
    egeekelaellkeidsklaaekasrdahdndgptveevd
    

    Sequence, based on observed residues (ATOM records):
    >5l0yF (F:)
    saninklresgnaeyrkqrygdaiklytlglqmaltrpawepaglvrdeihqlysnraqa
    ymqlgqwpeaaadaecsveakrqgnakawyrrgkclmemrrlqearewvarglefeeeke
    laellkeidsklaaekasrd
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5l0yG (G:)
    vnpkrsaninklresgnaeyrkqrygdaiklytlglqmaltrpawepaglvrdeihqlys
    nraqaymqlgqwpeaaadaecsveakrqgnakawyrrgkclmemrrlqearewvarglef
    egeekelaellkeidsklaaekasrdahdndgptveevd
    

    Sequence, based on observed residues (ATOM records):
    >5l0yG (G:)
    vnpkrsaninklresgnaeyrkqrygdaiklytlglqmaltrpawepaglvrdeihqlys
    nraqaymqlgqwpeaaadaecsveakrqgnakawyrrgkclmemrrlqearewvarglef
    kelaellkeidsklaaekasrdah
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5l0yH (H:)
    vnpkrsaninklresgnaeyrkqrygdaiklytlglqmaltrpawepaglvrdeihqlys
    nraqaymqlgqwpeaaadaecsveakrqgnakawyrrgkclmemrrlqearewvarglef
    egeekelaellkeidsklaaekasrdahdndgptveevd
    

    Sequence, based on observed residues (ATOM records):
    >5l0yH (H:)
    krsaninklresgnaeyrkqrygdaiklytlglqmaltrpaweprdeihqlysnraqaym
    qlgqwpeaaadaecsveakrqgnakawyrrgkclmemrrlqearewvarglefeekelae
    llkeidsklaaek
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5l0yI (I:)
    ptveevd
    

    Sequence, based on observed residues (ATOM records):
    >5l0yI (I:)
    tveevd
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >5l0yJ (J:)
    ptveevd
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >5l0yK (K:)
    ptveevd
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5l0yL (L:)
    ptveevd
    

    Sequence, based on observed residues (ATOM records):
    >5l0yL (L:)
    tveevd
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >5l0yM (M:)
    ptveevd
    

    Sequence, based on observed residues (ATOM records):
    >5l0yM (M:)
    veevd