PDB entry 5l0s

View 5l0s on RCSB PDB site
Description: human POGLUT1 in complex with Factor VII EGF1 and UDP
Class: transferase
Keywords: transferase glycosyltransferase GT-B glucosyltransferase, TRANSFERASE
Deposited on 2016-07-28, released 2017-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-24, with a file datestamp of 2021-03-19.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein O-glucosyltransferase 1
  Species: Homo sapiens [TaxId:9606]
  Gene: POGLUT1, C3orf9, CLP46, KTELC1, MDSRP, MDS010, UNQ490/PRO1006
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8NBL1 (Start-356)
• Chain 'B':
  Compound: Coagulation factor VII
  Species: Homo sapiens [TaxId:9606]
  Gene: F7
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08709 (Start-41)
  Domains in SCOPe 2.08: d5l0sb_
• Heterogens: NAG, UDP, CL, GOL, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >5l0sB (B:)
  gsdgdqcasspcqnggsckdqlqsyicfclpafegrncethk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5l0sB (B:)
  gdqcasspcqnggsckdqlqsyicfclpafegrncethk