PDB entry 5l0m

View 5l0m on RCSB PDB site
Description: hlrh-1 dna binding domain - 12bp oct4 promoter complex
Deposited on 2016-07-27, released 2016-11-09
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor subfamily 5 group A member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NR5A2, B1F, CPF, FTF
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA (5'-d(*gp*gp*tp*cp*ap*ap*gp*gp*cp*tp*ap*g)-3')
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
  • Chain 'C':
    Compound: DNA (5'-d(*cp*tp*ap*gp*cp*cp*tp*tp*gp*ap*cp*c)-3')
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l0mA (A:)
    gefdedleelcpvcgdkvsgyhyglltcesckgffkrtvqnnkrytcienqncqidktqr
    krcpycrfqkclsvgmkleavradrmrggrnkfgpmykrdralkqqkkalir
    

    Sequence, based on observed residues (ATOM records):
    >5l0mA (A:)
    eelcpvcgdkvsgyhyglltcesckgffkrtvqnnkrytcienqncqidktqrkrcpycr
    fqkclsvgmkleavradrmrggrnkfgpmykrdral
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.