PDB entry 5l0j

View 5l0j on RCSB PDB site
Description: human vinculin r903q, d907r, r910t mutant(residues 891-1066)
Deposited on 2016-07-27, released 2016-08-31
The last revision was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 4 Å
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vinculin
    Species: Homo sapiens [TaxId:9606]
    Gene: VCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18206 (0-End)
      • engineered mutation (12)
      • engineered mutation (16)
      • engineered mutation (19)
  • Chain 'B':
    Compound: vinculin
    Species: Homo sapiens [TaxId:9606]
    Gene: VCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18206
      • engineered mutation (12)
      • engineered mutation (16)
      • engineered mutation (19)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l0jA (A:)
    gevinqpmmmaaqqlhreatkwsskgndiiaaakrmallmaemsrlvrggsgtkraliqc
    akdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatmlgrtn
    isdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrktpwyq
    

    Sequence, based on observed residues (ATOM records):
    >5l0jA (A:)
    gevinqpmmmaaqqlhreatkwsskgndiiaaakrmallmaemsrlvrggsgtkraliqc
    akdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatmldees
    eqatemlvhnaqnlmqsvketvreaeaasiktdagftlrwvrktp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5l0jB (B:)
    gevinqpmmmaaqqlhreatkwsskgndiiaaakrmallmaemsrlvrggsgtkraliqc
    akdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatmlgrtn
    isdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrktpwyq
    

    Sequence, based on observed residues (ATOM records):
    >5l0jB (B:)
    vinqpmmmaaqqlhreatkwsskgndiiaaakrmallmaemsrlvrggsgtkraliqcak
    diakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatmldeeseq
    atemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrktpw