PDB entry 5l0h

View 5l0h on RCSB PDB site
Description: Human metavinculin MVt cardiomyopathy-associated mutant R975W (residues 959-1134) in complex with PIP2
Class: cell adhesion
Keywords: 5-Helix bundle, cytoskeletal protein, cell adhesion, cardiomyopathy
Deposited on 2016-07-27, released 2016-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vinculin
    Species: Homo sapiens [TaxId:9606]
    Gene: VCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18206
      • engineered mutation (16)
    Domains in SCOPe 2.08: d5l0ha_
  • Heterogens: PEG, PIO, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l0hA (A:)
    nqpvnqpilaaaqslhweatkwsskgndiiaaakrmallmaemsrlvrggsgtkraliqc
    akdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatmlgrtn
    isdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrktpwyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l0hA (A:)
    qpvnqpilaaaqslhweatkwsskgndiiaaakrmallmaemsrlvrggsgtkraliqca
    kdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatmlgrtni
    sdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrktpw