PDB entry 5l05

View 5l05 on RCSB PDB site
Description: Crystal structure of catalase-peroxidase KATG of burkholderia pseudomallei treated with INH
Class: oxidoreductase
Keywords: catalase, peroxidase, KatG, oxidoreductase
Deposited on 2016-07-26, released 2016-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalase-peroxidase
    Species: Burkholderia pseudomallei (strain 1710b) [TaxId:320372]
    Gene: katG, BURPS1710b_3366
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5l05a1, d5l05a2
  • Chain 'B':
    Compound: Catalase-peroxidase
    Species: Burkholderia pseudomallei (strain 1710b) [TaxId:320372]
    Gene: katG, BURPS1710b_3366
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5l05b1, d5l05b2
  • Heterogens: HP5, NA, OXY, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l05A (A:)
    msneakcpfhqaagngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaav
    krdlhalmttsqdwwpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswp
    dnanldkarrllwpikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedv
    ywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdt
    farmamndeetvaliagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgad
    aitsglevtwtttptqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskk
    hrptmlttdlslrfdpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp
    aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
    ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
    qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
    aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
    dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
    nldrfdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l05A (A:)
    gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdww
    padfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwpi
    kqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsggp
    nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
    agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
    qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
    payekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavdh
    plidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwea
    nqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpfa
    pgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvll
    gglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratgel
    kwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5l05B (B:)
    msneakcpfhqaagngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaav
    krdlhalmttsqdwwpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswp
    dnanldkarrllwpikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedv
    ywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdt
    farmamndeetvaliagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgad
    aitsglevtwtttptqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskk
    hrptmlttdlslrfdpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp
    aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
    ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
    qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
    aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
    dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
    nldrfdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l05B (B:)
    gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdww
    padfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwpi
    kqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsggp
    nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
    agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
    qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
    payekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavdh
    plidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwea
    nqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpfa
    pgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvll
    gglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratgel
    kwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla