PDB entry 5l04

View 5l04 on RCSB PDB site
Description: structure of interferon lambda 1 receptor with human kinase jak1
Deposited on 2016-07-26, released 2016-10-12
The last revision was dated 2017-04-12, with a file datestamp of 2017-04-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase JAK1
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK1, JAK1A, JAK1B
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Interferon lambda receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNLR1, IL28RA, LICR2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l04A (A:)
    gapepgvevifylsdreplrlgsgeytaeelciraaqacrisplchnlfalydentklwy
    apnrtitvddkmslrlhyrmrfyftnwhgtndneqsvwrhspkkqkngyekkkipdatpl
    ldassleylfaqgqydlvkclapirdpkteqdghdieneclgmavlaishyammkkmqlp
    elpkdisykryipetlnksirqrnlltrmrinnvfkdflkefnnkticdssvsthdlkvk
    ylatletltkhygaeifetsmllissenemnwfhsndggnvlyyevmvtgnlgiqwrhkp
    nvvsvekeknklkrkklenkhkkdeeknkireewnnfsyfpeithivikesvvsinkqdn
    kkmelklssheealsfvslvdgyfrltadahhylctdvapplivhniqngchgpicteya
    inklrqegseegmyvlrwsctdfdnilmtvtcfekseqvqgaqkqfknfqievqkgrysl
    hgsdrsfpslgdlmshlkkqilrtdnisfmlkrccqpkpreisnllvatkkaqewqpvyp
    msqlsfdrsg
    

    Sequence, based on observed residues (ATOM records):
    >5l04A (A:)
    gvevifylsdreplrlgsgeytaeelciraaqacrisplchnlfalydentklwyapnrt
    itvddkmslrlhyrmrfyftnwhgtndneqsvwrhspatplldassleylfaqgqydlvk
    clapirdpkteqdghdieneclgmavlaishyammkkmqlpesykryipetlnksirqrn
    lltrmrinnvfkdflkefnnkticdssvsthdlkvkylatletltkhygaeifetsmlli
    ssegnvlyyevmvtgnlgiqwrhkpewnnfsyfpeithivikesvvsinkqdnkkmelkl
    ssheealsfvslvdgyfrltadahhylctdvapplivhniqngchgpicteyainklrqe
    gseegmyvlrwsctdfdnilmtvtcfekqkqfknfqievqkgryslhgsdrsfpslgdlm
    shlkkqilrtdnisfmlkrccqpkpreisnllvatkkaqe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5l04B (B:)
    rakmpraldfsghthpvatfqpsrpesvndlflcpqkeltrgvrptpr
    

    Sequence, based on observed residues (ATOM records):
    >5l04B (B:)
    akmpraldfsghthpvatfqpsrpesvndlflcpqke