PDB entry 5l01

View 5l01 on RCSB PDB site
Description: tryptophan 5-hydroxylase in complex with inhibitor (3~{s})-8-[2- azanyl-6-[(1~{r})-1-(4-chloranyl-2-phenyl-phenyl)-2,2,2- tris(fluoranyl)ethoxy]pyrimidin-4-yl]-2,8-diazaspiro[4.5]decane-3- carboxylic acid
Deposited on 2016-07-26, released 2017-01-25
The last revision was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophan 5-hydroxylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TPH1, TPH, TPRH, TRPH
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, 6Z4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l01A (A:)
    miednkenkdhslergraslifslknevgglikalkifqekhvnllhiesrkskrrnsef
    eifvdcdinreqlndifhllkshtnvlsvnlpdnftlkedgmetvpwfpkkisdldhcan
    rvlmygseldadhpgfkdnvyrkrrkyfadlamnykhgdpipkvefteeeiktwgtvfqe
    lnklypthacreylknlpllskycgyrednipqledvsnflkertgfsirpvagylsprd
    flsglafrvfhctqyvrhssdpfytpepdtchellghvpllaepsfaqfsqeiglaslga
    seeavqklatcyfftvefglckqdgqlrvfgagllssiselkhalsghakvkpfdpkitc
    kqeclittfqdvyfvsesfedakekmreftktikrpfgvkynpytrsiqilkdtksitsa
    mnelqhdldvvsdalakvsrkpsi
    

    Sequence, based on observed residues (ATOM records):
    >5l01A (A:)
    tvpwfpkkisdldhcanrvlmyggfkdnvyrkrrkyfadlamnykhgdpipkvefteeei
    ktwgtvfqelnklypthacreylknlpllskycgyrednipqledvsnflkertgfsirp
    vagylsprdflsglafrvfhctqyvrhssdpfytpepdtchellghvpllaepsfaqfsq
    eiglaslgaseeavqklatcyfftvefglckqdgqlrvfgagllssiselkhalsghakv
    kpfdpkitckqeclittfqdvyfvsesfedakekmreftktik