PDB entry 5kzu

View 5kzu on RCSB PDB site
Description: Crystal structure of an acetylcholine binding protein from Aplysia californica (Ac-AChBP) in complex with click chemistry compound 9-[[1-[8-methyl-8-(2-phenylethyl)-8-azoniabicyclo[3.2.1]octan-3-yl]triazol-4-yl]methyl]carbazole
Class: acetylcholine-binding protein
Keywords: nicotinic, acetylcholine, AChBP, ACETYLCHOLINE-BINDING PROTEIN
Deposited on 2016-07-25, released 2016-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (7-8)
    Domains in SCOPe 2.07: d5kzua1, d5kzua2
  • Chain 'B':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (1-8)
    Domains in SCOPe 2.07: d5kzub1, d5kzub2
  • Chain 'C':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (5-8)
    Domains in SCOPe 2.07: d5kzuc1, d5kzuc2
  • Chain 'D':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (7-8)
    Domains in SCOPe 2.07: d5kzud1, d5kzud2
  • Chain 'E':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (5-8)
    Domains in SCOPe 2.07: d5kzue1, d5kzue2
  • Heterogens: SO4, PG4, 74S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kzuA (A:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzuA (A:)
    klhsqanlmrlksdlfnrpmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqr
    wklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfip
    aqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsa
    tqtrqvqhysccpepyidvnlvvkfre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kzuB (B:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzuB (B:)
    ykddddklhsqanlmrlksdlfpmypgptkddpltvtlgftlqdivkadsstnevdlvyy
    eqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsv
    mfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskye
    ilsatqtrqvqhysccpepyidvnlvvkfrer
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kzuC (C:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzuC (C:)
    ddklhsqanlmrlksdlfypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwk
    lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq
    rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq
    trqvqhysccpepyidvnlvvkfre
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kzuD (D:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzuD (D:)
    klhsqanlmrlksdlfnpmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
    klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
    qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
    qtrqvqhysccpepyidvnlvvkfre
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5kzuE (E:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzuE (E:)
    ddklhsqanlmrlksdlfnypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
    klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
    qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
    qtrqvqhysccpepyidvnlvvkfre