PDB entry 5kzn

View 5kzn on RCSB PDB site
Description: metabotropic glutamate receptor
Deposited on 2016-07-25, released 2016-12-28
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metabotropic glutamate receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRM2, GPRC1B, MGLUR2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kznA (A:)
    mgsllallallllwgavaegpakkvltlegdlvlgglfpvhqkggpaedcgpvnehrgiq
    rleamlfaldrinrdphllpgvrlgahildscskdthaleqaldfvraslsrgadgsrhi
    cpdgsyathgdaptaitgviggsysdvsiqvanllrlfqipqisyastsaklsdksrydy
    fartvppdffqakamaeilrffnwtyvstvasegdygetgieafeleararnicvatsek
    vgramsraafegvvrallqkpsarvavlftrsedarellaasqrlnasftwvasdgwgal
    esvvagsegaaegaitielasypisdfasyfqsldpwnnsrnpwfrefweqrfrcsfrqr
    dcaahslravpfeqeskimfvvnavyamahalhnmhralcpnttrlcdamrpvngrrlyk
    dfvlnvkfdapfrpadthnevrfdrfgdgigryniftylragsgryryqkvgywaegltl
    dtslipwaspsagplpasrcsepclqnevksvqpgevccwlcipcqpyeyrldeftcadc
    glgywpnasltgcfelpqeyireghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5kznA (A:)
    kkvltlegdlvlgglfpvhqkggpaedcgpvnehrgiqrleamlfaldrinrdphllpgv
    rlgahildscskdthaleqaldfvraslptaitgviggsysdvsiqvanllrlfqipqis
    yastsaklsdksrydyfartvppdffqakamaeilrffnwtyvstvasegdygetgieaf
    eleararnicvatsekvgramsraafegvvrallqkpsarvavlftrsedarellaasqr
    lnasftwvasdgwgalesvvagsegaaegaitielasypisdfasyfqsldpwnnsrnpw
    frefweqrfrcsfrqrdcaahslravpfeqeskimfvvnavyamahalhnmhralcpntt
    rlcdamrpvngrrlykdfvlnvkfdapfrpadthnevrfdrfgdgigryniftylraggr
    yryqkvgywaegltldtslipwaspsagplpasrcsepclqnevksvqpgevccwlcipc
    qpyeyrldeftcadcglgywpna