PDB entry 5kzi

View 5kzi on RCSB PDB site
Description: Crystal structure of human Pim-1 kinase in complex with an imidazopyridazine inhibitor.
Class: transferase/transferase inhibitor
Keywords: TRANSFERASE, serine/threonine protein kinase, transferase-transferase inhibitor complex
Deposited on 2016-07-25, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kzia_
  • Heterogens: 6YN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kziA (A:)
    mahhhhhhdevdgplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwge
    lpngtrvpmevvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergal
    qeelarsffwqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvyt
    dfdgtrvysppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrv
    ssecqhlirwclalrpsdrptfeeiqnhpwmqdvllpqetaeihlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kziA (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlh