PDB entry 5kzf

View 5kzf on RCSB PDB site
Description: crystal structure of near full-length hexameric mycobacterium tuberculosis proteasomal atpase mpa in apo form
Deposited on 2016-07-25, released 2017-05-17
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 3.49 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome-associated ATPase
    Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
    Gene: mpa, MRA_2130
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Proteasome-associated ATPase
    Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
    Gene: mpa, MRA_2130
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Proteasome-associated ATPase
    Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
    Gene: mpa, MRA_2130
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Proteasome-associated ATPase
    Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
    Gene: mpa, MRA_2130
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Proteasome-associated ATPase
    Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
    Gene: mpa, MRA_2130
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Proteasome-associated ATPase
    Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
    Gene: mpa, MRA_2130
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Proteasome-associated ATPase
    Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
    Gene: mpa, MRA_2130
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4E1 (1-End)
      • initiating methionine (0)
  • Chain 'H':
    Compound: Proteasome-associated ATPase
    Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
    Gene: mpa, MRA_2130
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4E1 (1-End)
      • initiating methionine (0)
  • Chain 'I':
    Compound: Proteasome-associated ATPase
    Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
    Gene: mpa, MRA_2130
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4E1 (1-End)
      • initiating methionine (0)
  • Chain 'J':
    Compound: Proteasome-associated ATPase
    Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
    Gene: mpa, MRA_2130
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4E1 (1-End)
      • initiating methionine (0)
  • Chain 'K':
    Compound: Proteasome-associated ATPase
    Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
    Gene: mpa, MRA_2130
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4E1 (1-End)
      • initiating methionine (0)
  • Chain 'L':
    Compound: Proteasome-associated ATPase
    Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
    Gene: mpa, MRA_2130
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kzfA (A:)
    mpsgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfe
    avgeistlreiladghralvvghadeervvwladpliaedlpdglpealnddtrprklrp
    gdsllvdtkagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhke
    lyreyslrppkgvllygppgcgktliakavanslakkmaevrgddaheaksyflnikgpe
    llnkfvgeterhirlifqrarekasegtpvivffdemdsifrtrgtgvssdvettvvpql
    lseidgveglenvivigasnredmidpailrpgrldvkikierpdaeaaqdiyskyltef
    lpvhaddlaefdgdrsacikamiekvvdrmyaeiddnrflevtyangdkevmyfkdfnsg
    amiqnvvdrakknaiksvletgqpglriqhlldsivdefaenedlpnttnpddwarisgk
    kgerivyirtlvtgksssasraidtesnlgqyl
    

    Sequence, based on observed residues (ATOM records):
    >5kzfA (A:)
    psgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfea
    vgeistlreiladghralvvghadeervvwladpliaedlptrprklrpgdsllvdtkag
    yaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhkelyreyslrppk
    gvllygppgcgktliakavanslakkmaevrgddaheaksyflnikgpellnkfvgeter
    hirlifqrarekasegtpvivffdemdsifvvpqllseidgveglenvivigasnredmi
    dpailrpgrldvkikierpdaeaaqdiyskylteflpvhaddlaefdgdrsacikamiek
    vvdrmyaeiddnrflevtyangdkevmyfkdfnsgamiqnvvdrakknaiksvletgqpg
    lriqhlldsivdefaenedlpnttnpddwarisgkkgerivyirtlvtgksssasraidt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kzfB (B:)
    mpsgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfe
    avgeistlreiladghralvvghadeervvwladpliaedlpdglpealnddtrprklrp
    gdsllvdtkagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhke
    lyreyslrppkgvllygppgcgktliakavanslakkmaevrgddaheaksyflnikgpe
    llnkfvgeterhirlifqrarekasegtpvivffdemdsifrtrgtgvssdvettvvpql
    lseidgveglenvivigasnredmidpailrpgrldvkikierpdaeaaqdiyskyltef
    lpvhaddlaefdgdrsacikamiekvvdrmyaeiddnrflevtyangdkevmyfkdfnsg
    amiqnvvdrakknaiksvletgqpglriqhlldsivdefaenedlpnttnpddwarisgk
    kgerivyirtlvtgksssasraidtesnlgqyl
    

    Sequence, based on observed residues (ATOM records):
    >5kzfB (B:)
    psgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfea
    vgeistlreiladghralvvghadeervvwladpliaedlpdglddtrprklrpgdsllv
    dtkagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhkelyreys
    lrppkgvllygppgcgktliakavanslakkmaksyflnikgpellnkfvgeterhirli
    fqrarekasegtpvivffdemdsifvvpqllseidgveglenvivigasnredmidpail
    rpgrldvkikierpdaeaaqdiyskylteflpvhaddlaefdgdrsacikamiekvvdrm
    yaeiddnrflevtyangdkevmyfkdfnsgamiqnvvdrakknaiksvletgqpglriqh
    lldsivdefaenedlpnttnpddwarisgkkgerivyirtlvtgksssasraidt
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5kzfC (C:)
    mpsgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfe
    avgeistlreiladghralvvghadeervvwladpliaedlpdglpealnddtrprklrp
    gdsllvdtkagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhke
    lyreyslrppkgvllygppgcgktliakavanslakkmaevrgddaheaksyflnikgpe
    llnkfvgeterhirlifqrarekasegtpvivffdemdsifrtrgtgvssdvettvvpql
    lseidgveglenvivigasnredmidpailrpgrldvkikierpdaeaaqdiyskyltef
    lpvhaddlaefdgdrsacikamiekvvdrmyaeiddnrflevtyangdkevmyfkdfnsg
    amiqnvvdrakknaiksvletgqpglriqhlldsivdefaenedlpnttnpddwarisgk
    kgerivyirtlvtgksssasraidtesnlgqyl
    

    Sequence, based on observed residues (ATOM records):
    >5kzfC (C:)
    psgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfea
    vgeistlreiladghralvvghadeervvwladpliaedlpdtrprklrpgdsllvdtka
    gyaferipkavpdvsyadigglsrqieqirdavelpflhkelyreyslrppkgvllygpp
    gcgktliakavanslakkmaevrgddaheaksyflnikgpellnkfvgeterhirlifqr
    arekasegtpvivffdemdsifvvpqllseidgveglevivigasnredmidpailrpgr
    ldvkikierpdaeaaqdiyskylteflpvhaddlaefdgdrsacikamiekvvdrmyaei
    ddnrflevtyangdkevmyfkdfnsgamiqnvvdrakknaiksvletgqpglriqhllds
    ivdefaenedlpnttnpddwarisgkkgerivyirtlvtgksssasraidte
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5kzfD (D:)
    mpsgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfe
    avgeistlreiladghralvvghadeervvwladpliaedlpdglpealnddtrprklrp
    gdsllvdtkagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhke
    lyreyslrppkgvllygppgcgktliakavanslakkmaevrgddaheaksyflnikgpe
    llnkfvgeterhirlifqrarekasegtpvivffdemdsifrtrgtgvssdvettvvpql
    lseidgveglenvivigasnredmidpailrpgrldvkikierpdaeaaqdiyskyltef
    lpvhaddlaefdgdrsacikamiekvvdrmyaeiddnrflevtyangdkevmyfkdfnsg
    amiqnvvdrakknaiksvletgqpglriqhlldsivdefaenedlpnttnpddwarisgk
    kgerivyirtlvtgksssasraidtesnlgqyl
    

    Sequence, based on observed residues (ATOM records):
    >5kzfD (D:)
    psgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfea
    vgeistlreiladghralvvghadeervvwladpliaedlpdtrprklrpgdsllvdtka
    gyaferippdvsyadigglsrqieqirdavelpflhkelyreyslrppkgvllygppgcg
    ktliakavanslakkmaksyflnikgpellnkfvgeterhirlifqrarekasegtpviv
    ffdemdsifvvpqllseidgveglenvivigasnredmidpailrpgrldvkikierpda
    eaaqdiyskylteflpvhaddlaefdgdrsacikamiekvvdrmyaeiddnrflevtyan
    gdkevmyfkdfnsgamiqnvvdrakknaiksvletgqpglriqhlldsivdefaenedlp
    nttnpddwarisgkkgerivyirtlvtgksssasraidte
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5kzfE (E:)
    mpsgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfe
    avgeistlreiladghralvvghadeervvwladpliaedlpdglpealnddtrprklrp
    gdsllvdtkagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhke
    lyreyslrppkgvllygppgcgktliakavanslakkmaevrgddaheaksyflnikgpe
    llnkfvgeterhirlifqrarekasegtpvivffdemdsifrtrgtgvssdvettvvpql
    lseidgveglenvivigasnredmidpailrpgrldvkikierpdaeaaqdiyskyltef
    lpvhaddlaefdgdrsacikamiekvvdrmyaeiddnrflevtyangdkevmyfkdfnsg
    amiqnvvdrakknaiksvletgqpglriqhlldsivdefaenedlpnttnpddwarisgk
    kgerivyirtlvtgksssasraidtesnlgqyl
    

    Sequence, based on observed residues (ATOM records):
    >5kzfE (E:)
    psgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfea
    vgeistlreiladghralvvghadeervvwladpliaedlpddtrprklrpgdsllvdtk
    agyaferipkapdvsyadigglsrqieqirdavelpflhkelyreyslrppkgvllygpp
    gcgktliakavanslakkmasyflnikgpellnkfvgeterhirlifqrarekasegtpv
    ivffdemdsifvvpqllseidgveglenvivigasnredmidpailrpgrldvkikierp
    daeaaqdiyskylteflpvhaddlaefdgdrsacikamiekvvdrmyaeiddnrflevty
    angdkevmyfkdfnsgamiqnvvdrakknaiksvletgqpglriqhlldsivdefaened
    lpnttnpddwarisgkkgerivyirtlvtgksssasraidt
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5kzfF (F:)
    mpsgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfe
    avgeistlreiladghralvvghadeervvwladpliaedlpdglpealnddtrprklrp
    gdsllvdtkagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhke
    lyreyslrppkgvllygppgcgktliakavanslakkmaevrgddaheaksyflnikgpe
    llnkfvgeterhirlifqrarekasegtpvivffdemdsifrtrgtgvssdvettvvpql
    lseidgveglenvivigasnredmidpailrpgrldvkikierpdaeaaqdiyskyltef
    lpvhaddlaefdgdrsacikamiekvvdrmyaeiddnrflevtyangdkevmyfkdfnsg
    amiqnvvdrakknaiksvletgqpglriqhlldsivdefaenedlpnttnpddwarisgk
    kgerivyirtlvtgksssasraidtesnlgqyl
    

    Sequence, based on observed residues (ATOM records):
    >5kzfF (F:)
    psgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfea
    vgeistlreiladghralvvghadeervvwladplilrpgdsllvdtkagyaferipkae
    vedlvleevpdvsyadigglsrqieqirdavelpflhkelyreyslrppkgvllygppgc
    gktliakavanslakkmaksyflnikgpellnkfvgeterhirlifqrarekasegtpvi
    vffdemdsifvvpqllseidgveglenvivigasnredmidpailrpgrldvkikierpd
    aeaaqdiyskylteflpvhaddlaefdgdrsacikamiekvvdrmyaeiddnrflevtya
    ngdkevmyfkdfnsgamiqnvvdrakknaiksvletgqpglriqhlldsivdefaenedl
    pnttnpddwarisgkkgerivyirtlvtgksssasraidt
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5kzfG (G:)
    mpsgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfe
    avgeistlreiladghralvvghadeervvwladpliaedlpdglpealnddtrprklrp
    gdsllvdtkagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhke
    lyreyslrppkgvllygppgcgktliakavanslakkmaevrgddaheaksyflnikgpe
    llnkfvgeterhirlifqrarekasegtpvivffdemdsifrtrgtgvssdvettvvpql
    lseidgveglenvivigasnredmidpailrpgrldvkikierpdaeaaqdiyskyltef
    lpvhaddlaefdgdrsacikamiekvvdrmyaeiddnrflevtyangdkevmyfkdfnsg
    amiqnvvdrakknaiksvletgqpglriqhlldsivdefaenedlpnttnpddwarisgk
    kgerivyirtlvtgksssasraidtesnlgqyl
    

    Sequence, based on observed residues (ATOM records):
    >5kzfG (G:)
    mpsgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfe
    avgeistlreiladghralvvghadeervvwladplilrpgdsllvdtkagyaferipka
    evedlvleevpdvsyadigglsrqieqirdavelpflhkelyreyslrppkgvllygppg
    cgktliakavanslakkmasyflnikgpellnkfvgeterhirlifqrarekasegtpvi
    vffdemdsiftvvpqllseidgveglenvivigasnredmidpailrpgrldvkikierp
    daeaaqdiyskylteflpvhaddlaefdgdrsacikamiekvvdrmyaeiddnrflevty
    angdkevmyfkdfnsgamiqnvvdrakknaiksvletgqpglriqhlldsivdefaened
    lpnttnpddwarisgkkgerivyirtlvtgksssasraidt
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5kzfH (H:)
    mpsgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfe
    avgeistlreiladghralvvghadeervvwladpliaedlpdglpealnddtrprklrp
    gdsllvdtkagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhke
    lyreyslrppkgvllygppgcgktliakavanslakkmaevrgddaheaksyflnikgpe
    llnkfvgeterhirlifqrarekasegtpvivffdemdsifrtrgtgvssdvettvvpql
    lseidgveglenvivigasnredmidpailrpgrldvkikierpdaeaaqdiyskyltef
    lpvhaddlaefdgdrsacikamiekvvdrmyaeiddnrflevtyangdkevmyfkdfnsg
    amiqnvvdrakknaiksvletgqpglriqhlldsivdefaenedlpnttnpddwarisgk
    kgerivyirtlvtgksssasraidtesnlgqyl
    

    Sequence, based on observed residues (ATOM records):
    >5kzfH (H:)
    mpsgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfe
    avgeistlreiladghralvvghadeervvwladpliaedlpdglpetrprklrpgdsll
    vdtkagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhkelyrey
    slrppkgvllygppgcgktliakavanslakkmasyflnikgpellnkfvgeterhirli
    fqrarekasegtpvivffdemdsifettvvpqllseidgveglenvivigasnredmidp
    ailrpgrldvkikierpdaeaaqdiyskylteflpvhaddlaefdgdrsacikamiekvv
    drmyaeiddnrflevtyangdkevmyfkdfnsgamiqnvvdrakknaiksvletgqpglr
    iqhlldsivdefaenedlpnttnpddwarisgkkgerivyirtlvtgksssasraidt
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5kzfI (I:)
    mpsgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfe
    avgeistlreiladghralvvghadeervvwladpliaedlpdglpealnddtrprklrp
    gdsllvdtkagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhke
    lyreyslrppkgvllygppgcgktliakavanslakkmaevrgddaheaksyflnikgpe
    llnkfvgeterhirlifqrarekasegtpvivffdemdsifrtrgtgvssdvettvvpql
    lseidgveglenvivigasnredmidpailrpgrldvkikierpdaeaaqdiyskyltef
    lpvhaddlaefdgdrsacikamiekvvdrmyaeiddnrflevtyangdkevmyfkdfnsg
    amiqnvvdrakknaiksvletgqpglriqhlldsivdefaenedlpnttnpddwarisgk
    kgerivyirtlvtgksssasraidtesnlgqyl
    

    Sequence, based on observed residues (ATOM records):
    >5kzfI (I:)
    mpsgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfe
    avgeistlreiladghralvvghadeervvwladpliaedlpdglddtrprklrpgdsll
    vdtkagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhkelyrey
    slrppkgvllygppgcgktliakavanslakkmasyflnikgpellnkfvgeterhirli
    fqrarekasegtpvivffdemdsifrtrvvpqllseidgveglenvivigasnredmidp
    ailrpgrldvkikierpdaeaaqdiyskylteflpvhaddlaefdgdrsacikamiekvv
    drmyaeiddnrflevtyangdkevmyfkdfnsgamiqnvvdrakknaiksvletgqpglr
    iqhlldsivdefaenedlpnttnpddwarisgkkgerivyirtlvtgksssasraidt
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >5kzfJ (J:)
    mpsgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfe
    avgeistlreiladghralvvghadeervvwladpliaedlpdglpealnddtrprklrp
    gdsllvdtkagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhke
    lyreyslrppkgvllygppgcgktliakavanslakkmaevrgddaheaksyflnikgpe
    llnkfvgeterhirlifqrarekasegtpvivffdemdsifrtrgtgvssdvettvvpql
    lseidgveglenvivigasnredmidpailrpgrldvkikierpdaeaaqdiyskyltef
    lpvhaddlaefdgdrsacikamiekvvdrmyaeiddnrflevtyangdkevmyfkdfnsg
    amiqnvvdrakknaiksvletgqpglriqhlldsivdefaenedlpnttnpddwarisgk
    kgerivyirtlvtgksssasraidtesnlgqyl
    

    Sequence, based on observed residues (ATOM records):
    >5kzfJ (J:)
    mpsgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfe
    avgeistlreiladghralvvghadeervvwladpliaedlpdglpealnddtrprklrp
    gdsllvdtkagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhke
    lyreyslrppkgvllygppgcgktliakavanslakkmasyflnikgpellnkfvgeter
    hirlifqrarekasegtpvivffdemdsifettvvpqllseidgveglenvivigasnre
    dmidpailrpgrldvkikierpdaeaaqdiyskylteflpvhaddlaefdgdrsacikam
    iekvvdrmyaeiddnrflevtyangdkevmyfkdfnsgamiqnvvdrakknaiksvletg
    qpglriqhlldsivdefaenedlpnttnpddwarisgkkgerivyirtlvtgksssasra
    idte
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >5kzfK (K:)
    mpsgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfe
    avgeistlreiladghralvvghadeervvwladpliaedlpdglpealnddtrprklrp
    gdsllvdtkagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhke
    lyreyslrppkgvllygppgcgktliakavanslakkmaevrgddaheaksyflnikgpe
    llnkfvgeterhirlifqrarekasegtpvivffdemdsifrtrgtgvssdvettvvpql
    lseidgveglenvivigasnredmidpailrpgrldvkikierpdaeaaqdiyskyltef
    lpvhaddlaefdgdrsacikamiekvvdrmyaeiddnrflevtyangdkevmyfkdfnsg
    amiqnvvdrakknaiksvletgqpglriqhlldsivdefaenedlpnttnpddwarisgk
    kgerivyirtlvtgksssasraidtesnlgqyl
    

    Sequence, based on observed residues (ATOM records):
    >5kzfK (K:)
    mpsgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfe
    avgeistlreiladghralvvghadeervvwladpliaedlpdglpealnddtrprklrp
    gdsllvdtkagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhke
    lyreyslrppkgvllygppgcgktliakavanslakkmaevrgddaheaksyflnikgpe
    llnkfvgeterhirlifqrarekasegtpvivffdemdsifrtrvettvvpqllseidgv
    eglenvivigasnredmidpailrpgrldvkikierpdaeaaqdiyskylteflpvhadd
    laefdgdrsacikamiekvvdrmyaeiddnrflevtyangdkevmyfkdfnsgamiqnvv
    drakknaiksvletgqpglriqhlldsivdefaenedlpnttnpddwarisgkkgerivy
    irtlvtgksssasraidt
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5kzfL (L:)
    mpsgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfe
    avgeistlreiladghralvvghadeervvwladpliaedlpdglpealnddtrprklrp
    gdsllvdtkagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhke
    lyreyslrppkgvllygppgcgktliakavanslakkmaevrgddaheaksyflnikgpe
    llnkfvgeterhirlifqrarekasegtpvivffdemdsifrtrgtgvssdvettvvpql
    lseidgveglenvivigasnredmidpailrpgrldvkikierpdaeaaqdiyskyltef
    lpvhaddlaefdgdrsacikamiekvvdrmyaeiddnrflevtyangdkevmyfkdfnsg
    amiqnvvdrakknaiksvletgqpglriqhlldsivdefaenedlpnttnpddwarisgk
    kgerivyirtlvtgksssasraidtesnlgqyl
    

    Sequence, based on observed residues (ATOM records):
    >5kzfL (L:)
    psgygvllathdddtvdvftsgrkmrltcspnidaaslkkgqtvrlnealtvveagtfea
    vgeistlreiladghralvvghadeervvwladpliaedlpdddtrprklrpgdsllvdt
    kagyaferipkaevedlvleevpdvsyadigglsrqieqirdavelpflhkelyreyslr
    ppkgvllygppgcgktliakavanslakkmaksyflnikgpellnkfvgeterhirlifq
    rarekasegtpvivffdemdsifvvpqllseidgveglenvivigasnredmidpailrp
    grldvkikierpdaeaaqdiyskylteflpvhaddlaefdgdrsacikamiekvvdrmya
    eiddnrflevtyangdkevmyfkdfnsgamiqnvvdrakknaiksvletgqpglriqhll
    dsivdefaenedlpnttnpddwarisgkkgerivyirtlvtgksssasraidt