PDB entry 5kyw

View 5kyw on RCSB PDB site
Description: crystal structure of sec23 and tango1 peptide3 complex
Deposited on 2016-07-22, released 2016-09-07
The last revision was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein transport protein Sec23A
    Species: Homo sapiens [TaxId:9606]
    Gene: SEC23A
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protein transport protein Sec24D
    Species: Homo sapiens [TaxId:9606]
    Gene: SEC24D, KIAA0755
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94855 (3-End)
      • expression tag (0-2)
  • Chain 'C':
    Compound: TANGO1 peptide3
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KYW
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kywA (A:)
    mttylefiqqneerdgvrfswnvwpssrleatrmvvpvaalftplkerpdlppiqyepvl
    csrttcravlnplcqvdyraklwacnfcyqrnqfppsyagiselnqpaellpqfssieyv
    vlrgpqmpliflyvvdtcmededlqalkesmqmslsllpptalvglitfgrmvqvhelgc
    egisksyvfrgtkdlsakqlqemlglskvpltqatrgpqvqqpppsnrflqpvqkidmnl
    tdllgelqrdpwpvpqgkrplrssgvalsiavgllectfpntgarimmfiggpatqgpgm
    vvgdelktpirswhdidkdnakyvkkgtkhfealanraattghvidiyacaldqtgllem
    kccpnltggymvmgdsfntslfkqtfqrvftkdmhgqfkmgfggtleiktsreikisgai
    gpcvslnskgpcvseneigtggtcqwkicglsptttlaiyfevvnqhnapipqggrgaiq
    fvtqyqhssgqrrirvttiarnwadaqtqiqniaasfdqeaaailmarlaiyraeteegp
    dvlrwldrqlirlcqkfgeyhkddpssfrfsetfslypqfmfhlrrssflqvfnnspdes
    syyrhhfmrqdltqslimiqpilyaysfsgppepvlldsssiladrillmdtffqiliyh
    getiaqwrksgyqdmpeyenfrhllqapvddaqeilhsrfpmpryidtehggsqarflls
    kvnpsqthnnmyawgqesgapiltddvslqvfmdhlkklavssaa
    

    Sequence, based on observed residues (ATOM records):
    >5kywA (A:)
    tylefiqqneerdgvrfswnvwpssrleatrmvvpvaalftplkerpdlppiqyepvlcs
    rttcravlnplcqvdyraklwacnfcyqrnqfppsyagiselnqpaellpqfssieyvvl
    rgpqmpliflyvvdtcmededlqalkesmqmslsllpptalvglitfgrmvqvhelgceg
    isksyvfrgtkdlsakqlqemlglskvsnrflqpvqkidmnltdllgelqrdpwpvpqgk
    rplrssgvalsiavgllectfpntgarimmfiggpatqgpgmvvgdelktpirswhdidk
    dnakyvkkgtkhfealanraattghvidiyacaldqtgllemkccpnltggymvmgdsfn
    tslfkqtfqrvftkdmhgqfkmgfggtleiktsreikisgaigpcvslnskgpcvsenei
    gtggtcqwkicglsptttlaiyfevvgrgaiqfvtqyqhssgqrrirvttiarnwadaqt
    qiqniaasfdqeaaailmarlaiyraeteegpdvlrwldrqlirlcqkfgeyhkddpssf
    rfsetfslypqfmfhlrrssflqvfnnspdessyyrhhfmrqdltqslimiqpilyaysf
    sgppepvlldsssiladrillmdtffqiliyhgeiaqwrksgydmpeyenfrhllqapvd
    daqeilhsrfpmpryidtehggsqarfllskvpiltddvslqvfmdhlkklavs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kywB (B:)
    amgspiqviendrasrggqvyatntrgqipplvttdcmiqdqgnasprfircttycfpct
    sdmakqaqiplaavikpfatipsnesplylvnhgesgpvrcnrckaymcpfmqfieggrr
    yqcgfcncvndvppfyfqhldhigrrldhyekpelslgsyeyvatldycrkskppnppaf
    ifmidvsysniknglvkliceelktmlekipkeeqeetsairvgfitynkvlhffnvksn
    laqpqmmvvtdvgevfvplldgflvnyqesqsvihnlldqipdmfadsnenetvfapviq
    agmealkaadcpgklfifhsslptaeapgklknrddkklvntdkekilfqpqtnvydsla
    kdcvahgcsvtlflfpsqyvdvaslglvpqltggtlykynnfqmhldrqqflndlrndie
    kkigfdaimrvrtstgfratdffggilmnnttdvemaaidcdkavtvefkhddklsedsg
    aliqcavlyttisgqrrlrihnlglncssqladlykscetdalinffaksafkavlhqpl
    kvireilvnqtahmlacyrkncaspsaasqlilpdsmkvlpvymncllkncvllsrpeis
    tderayqrqlvmtmgvadsqlffypqllpihtldvkstmlpaavrcsesrlseegiflla
    nglhmflwlgvssppeliqgifnvpsfahintdmtllpevgnpysqqlrmimgiiqqkrp
    ysmkltivkqreqpemvfrqflvedkglyggssyvdflccvhkeicqlln
    

    Sequence, based on observed residues (ATOM records):
    >5kywB (B:)
    amgspiqviendrasrggqvyatntrgqipplvttdcmiqdqgnasprfircttycfpct
    sdmakqaqiplaavikpfatipsnesplylvnhgesgpvrcnrckaymcpfmqfieggrr
    yqcgfcncvndvppfyfqhldhigrrldhyekpelslgsyeyvatldycrkskppnppaf
    ifmidvsysniknglvkliceelktmlekipkeeqeetsairvgfitynkvlhffnvksn
    laqpqmmvvtdvgevfvplldgflvnyqesqsvihnlldqipdmfadsnenetvfapviq
    agmealkaadcpgklfifhsslptaeapgklknrddkklvntdkekilfqpqtnvydsla
    kdcvahgcsvtlflfpsqyvdvaslglvpqltggtlykynnfqmhldrqqflndlrndie
    kkigfdaimrvrtstgfratdffggilmnnttdvemaaidcdkavtvefkhddklsedsg
    aliqcavlyttisgqrrlrihnlglncssqladlykscetdalinffaksafkavlhqpl
    kvireilvnqtahmlacyrkncaspsaasqlilpdsmkvlpvymncllkncvllsrpeis
    tderayqrqlvmtmgvadsqlffypqllpihtldvkstmlpaavrcsesrlseegiflla
    nglhmflwlgvssppeliqgifnvpsfahintdmtllpevgnpysqqlrmimgiiqqkrp
    ysmkltivkqreqpemvfrqflvedkggssyvdflccvhkeicqll
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5kywC (C:)
    lpppfgpgm
    

    Sequence, based on observed residues (ATOM records):
    >5kywC (C:)
    ppp